DHX8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DHX8 Antibody [NBP2-13923] - Staining of human cell line HEK 293 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human cerebellum shows strong cytoplasmic and nucleolar positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHX8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAE GRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHX8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DHX8 Protein (NBP2-13923PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHX8 Antibody

  • DDX8ATP-dependent RNA helicase DHX8
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase)
  • DEAH (Asp-Glu-Ala-His) box polypeptide 8
  • DEAH box protein 8
  • DEAH-box protein 8
  • EC 3.6.1
  • EC 3.6.4.13
  • HRH1RNA helicase HRH1
  • PRP22
  • PRPF22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
NB100-586
Species: Hu
Applications: WB, IP
NB600-812
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-58541
Species: Hu
Applications: ICC/IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NLS476
Species: Hu, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00079092-T01
Species: Hu
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
AF7637
Species: Hu
Applications: WB
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-58978
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Sh
Applications: ELISA, IHC-P
AF5745
Species: Hu
Applications: WB, IHC

Publications for DHX8 Antibody (NBP2-13923) (0)

There are no publications for DHX8 Antibody (NBP2-13923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX8 Antibody (NBP2-13923) (0)

There are no reviews for DHX8 Antibody (NBP2-13923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DHX8 Antibody (NBP2-13923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX8 Products

Bioinformatics Tool for DHX8 Antibody (NBP2-13923)

Discover related pathways, diseases and genes to DHX8 Antibody (NBP2-13923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX8 Antibody (NBP2-13923)

Discover more about diseases related to DHX8 Antibody (NBP2-13923).
 

Pathways for DHX8 Antibody (NBP2-13923)

View related products by pathway.

Blogs on DHX8

There are no specific blogs for DHX8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX8