DARS Antibody

Images

 
Independent Antibodies: Western Blot: DARS Antibody [NBP1-85937] - Analysis using Anti-DARS antibody NBP1-85937 (A) shows similar pattern to independent antibody NBP1-86027 (B).
Immunohistochemistry-Paraffin: DARS Antibody [NBP1-85937] - Staining of human testis.
Western Blot: DARS Antibody [NBP1-85937] - Analysis in human cell line A-431.
Western Blot: DARS Antibody [NBP1-85937] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Genetic Strategies: Western Blot: DARS Antibody [NBP1-85937] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-DARS antibody. Remaining relative intensity is ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: DARS Antibody [NBP1-85937] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DARS antibody NBP1-85937 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: DARS Antibody [NBP1-85937] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: DARS Antibody [NBP1-85937] - Staining of human kidney.
Immunohistochemistry-Paraffin: DARS Antibody [NBP1-85937] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDV
Specificity
Specificity of human DARS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DARS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DARS Protein (NBP1-85937PEP)
Publications
Read Publications using
NBP1-85937 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DARS Antibody

  • aspartate tRNA ligase 1, cytoplasmic
  • Aspartate--tRNA ligase
  • aspartyl-tRNA synthetase
  • aspartyl-tRNA synthetase, cytoplasmic
  • aspRS
  • Cell proliferation-inducing gene 40 protein
  • cell proliferation-inducing protein 40
  • DKFZp781B11202
  • EC 6.1.1.12
  • MGC111579

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82077
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006301-M01
Species: Hu, Mu, Ze
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-92835
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-90079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67593
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56375
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for DARS Antibody (NBP1-85937)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for DARS Antibody (NBP1-85937) (0)

There are no reviews for DARS Antibody (NBP1-85937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DARS Antibody (NBP1-85937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DARS Products

Bioinformatics Tool for DARS Antibody (NBP1-85937)

Discover related pathways, diseases and genes to DARS Antibody (NBP1-85937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DARS Antibody (NBP1-85937)

Discover more about diseases related to DARS Antibody (NBP1-85937).
 

Pathways for DARS Antibody (NBP1-85937)

View related products by pathway.

Blogs on DARS

There are no specific blogs for DARS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DARS1