| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, Mycoplasma |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DARS Antibody - BSA Free (NBP1-85937) is a polyclonal antibody validated for use in IHC and WB. Anti-DARS Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDV |
| Predicted Species | Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DARS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-85937 | Applications | Species |
|---|---|---|
| Frohlich D, Suchowerska AK, Spencer ZH et al. In vivocharacterization of the aspartyl-tRNA synthetase DARS: Homing in on the leukodystrophy HBSL. Neurobiol. Dis. 2017-01-01 [PMID: 27816769] (Mouse) | Mouse | |
| Klugmann M, Suchowerska A, Housley G, Fröhlich D Histological and biochemical methods to assess aminoacyl-tRNA synthetase expression in human post-mortem brain tissue Rare Disease and Orphan Drugs Journal 2023-04-20 (Western Blot, Human) | Western Blot | Human |
| Frohlich D, Suchowerska AK, Voss C et al. Expression Pattern of the Aspartyl-tRNA Synthetase DARS in the Human Brain. Front Mol Neurosci 2018-03-20 [PMID: 29615866] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for DARS Antibody (NBP1-85937)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DARS1 |