DDX41 Antibody (2F4)

Images

 
Western Blot: DDX41 Antibody (2F4) [H00051428-M01] - DDX41 monoclonal antibody (M01), clone 2F4 Analysis of DDX41 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: DDX41 Antibody (2F4) [H00051428-M01] - Analysis of monoclonal antibody to DDX41 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: DDX41 Antibody (2F4) [H00051428-M01] - Analysis of DDX41 expression in transfected 293T cell line by DDX41 monoclonal antibody (M01), clone 2F4.Lane 1: DDX41 transfected lysate(70 KDa).Lane 2: ...read more
ELISA: DDX41 Antibody (2F4) [H00051428-M01] - Detection limit for recombinant GST tagged DDX41 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DDX41 Antibody (2F4) Summary

Immunogen
DDX41 (NP_057306, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF
Specificity
DDX41 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DDX41
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00051428-M01 in the following applications:

Publications
Read Publications using
H00051428-M01 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23142775)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDX41 Antibody (2F4)

  • ABSDEAD-box protein abstrakt
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
  • DEAD box protein 41
  • DEAD box protein abstrakt homolog
  • EC 3.6.1
  • EC 3.6.4.13,2900024F02Rik
  • MGC8828
  • probable ATP-dependent RNA helicase DDX41
  • putative RNA helicase

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80849
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4859
Species: Hu
Applications: WB
NBP1-47914
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP3-12262
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF2030
Species: Hu
Applications: IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB200-351
Species: Ha, Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-59677
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94256
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20849
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-20619
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for DDX41 Antibody (H00051428-M01)(5)

Review for DDX41 Antibody (H00051428-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00051428-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot DDX41 H00051428-M01
Enlarge
4
reviewed by:
Jayashree Karar
WB Human 02/11/2015
View

Summary

ApplicationWestern Blot
Sample TestedHEK CELL LYSATE
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX41 Antibody (H00051428-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX41 Products

Bioinformatics Tool for DDX41 Antibody (H00051428-M01)

Discover related pathways, diseases and genes to DDX41 Antibody (H00051428-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX41 Antibody (H00051428-M01)

Discover more about diseases related to DDX41 Antibody (H00051428-M01).
 

Pathways for DDX41 Antibody (H00051428-M01)

View related products by pathway.

PTMs for DDX41 Antibody (H00051428-M01)

Learn more about PTMs related to DDX41 Antibody (H00051428-M01).
 

Research Areas for DDX41 Antibody (H00051428-M01)

Find related products by research area.

Blogs on DDX41

There are no specific blogs for DDX41, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Jayashree Karar
02/11/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol DDX41
Entrez
OMIM
Uniprot