DDX17 Antibody - BSA Free

Western Blot: DDX17 Antibody [NBP2-87261] - WB Suggested Anti-DDX17 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysateDDX17 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DDX17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX17 Antibody - BSA Free (NBP2-87261) is a polyclonal antibody validated for use in WB. Anti-DDX17 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human DDX17. Peptide sequence: PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DDX17 Antibody - BSA Free

• DDX17
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 17
• DEAD box protein 17
• DEAD box protein p72
• DEAD/H box 17
• DKFZp761H2016
• EC 3.6.1
• EC 3.6.4.13
• p72
• P72DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)
• probable ATP-dependent RNA helicase DDX17
• RH70
• RNA-dependent helicase p72

Background

DDX17 (p72) is a highly related member of the DEAD box family and is an established RNA helicase. It has been implicated in growth regulation and has been shown to be involved in both pre-mRNA and pre-rRNA processing. This protein has also been reported to act as a transcriptional co-activator for estrogen-receptor alpha (ER ) and shown to interact with co-activators p300/CBP and the RNA polymerase II holoenzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DDX17 Antibody (NBP2-87261)(1)

Publication using NBP2-87261

• Malvi P, Chava S, Cai G et al. HOXC6 drives a therapeutically targetable pancreatic cancer growth and metastasis pathway by regulating MSK1 and PPP2R2B Cell reports. Medicine 2023-11-21 [PMID: 37951219]

Bioinformatics

• Gene Symbol: DDX17