DDX1 Antibody

Images

 
Western Blot: DDX1 Antibody [NBP1-85294] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-151
Immunocytochemistry/ Immunofluorescence: DDX1 Antibody [NBP1-85294] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Western Blot: DDX1 Antibody [NBP1-85294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate ( Rat bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX1 Protein (NBP1-85294PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX1 Antibody

  • ATP-dependent RNA helicase DDX1
  • DBP-RB
  • DBP-RBDEAD box polypeptide 1
  • DDX1
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
  • DEAD box protein 1
  • DEAD box protein retinoblastoma
  • DEAD Box-1
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1
  • DEAD/H-Box Helicase 1
  • EC 3.6.1
  • EC 3.6.1.10
  • EC 3.6.4.13
  • UKVH5d

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
AF755
Species: Mu
Applications: WB, Block
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DDX1 Antibody (NBP1-85294) (0)

There are no publications for DDX1 Antibody (NBP1-85294).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX1 Antibody (NBP1-85294) (0)

There are no reviews for DDX1 Antibody (NBP1-85294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX1 Antibody (NBP1-85294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX1 Products

Bioinformatics Tool for DDX1 Antibody (NBP1-85294)

Discover related pathways, diseases and genes to DDX1 Antibody (NBP1-85294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX1 Antibody (NBP1-85294)

Discover more about diseases related to DDX1 Antibody (NBP1-85294).
 

Pathways for DDX1 Antibody (NBP1-85294)

View related products by pathway.

PTMs for DDX1 Antibody (NBP1-85294)

Learn more about PTMs related to DDX1 Antibody (NBP1-85294).
 

Research Areas for DDX1 Antibody (NBP1-85294)

Find related products by research area.

Blogs on DDX1

There are no specific blogs for DDX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX1
Entrez