DDX3 Antibody

Images

 
Western Blot: DDX3 Antibody [NBP1-85291] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: DDX3 Antibody [NBP1-85291] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: DDX3 Antibody [NBP1-85291] - Staining of human cerebellum shows moderate nuclear immunoreactivity in neurons.
Western Blot: DDX3 Antibody [NBP1-85291] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more
Western Blot: DDX3 Antibody [NBP1-85291] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: DDX3 Antibody [NBP1-85291] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Western Blot: DDX3 Antibody [NBP1-85291] - Analysis in human cell line SiHa.
Immunocytochemistry/ Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mouse medulla shows strong cytoplasmic immunoreactivity in neurons of the facial nucleus.
Immunocytochemistry/ Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus.
Immunocytochemistry/ Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mouse hippocampus shows cytoplasmic immunoreactivity in a subset of neurons in the CA2/CA3 areas.
Immunocytochemistry/ Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mouse parietal association cortex shows strong cytoplasmic positivity in neurons.
Immunocytochemistry/ Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mouse midbrain shows neuronal positivity in the red nucleus.
Immunohistochemistry-Paraffin: DDX3 Antibody [NBP1-85291] - Staining of human appendix shows strong cytoplasmic positivity in reaction center cells in lymphoid tissue.
Immunohistochemistry-Paraffin: DDX3 Antibody [NBP1-85291] - Staining of human hippocampus shows moderate positivity in neurons.
Immunohistochemistry-Paraffin: DDX3 Antibody [NBP1-85291] - Staining of human cerebral cortex shows moderate nuclear immunoreactivity in neuronal cell bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
Specificity
Specificity of human, mouse, rat DDX3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX3X
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
DDX3 Protein (NBP1-85291PEP)
Publications
Read Publications using NBP1-85291.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23764425)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX3 Antibody

  • DBXCAP-Rf
  • DDX14
  • DDX3DEAD/H box-3
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
  • DEAD box protein 3, X-chromosomal
  • DEAD box, X isoform
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3
  • EC 3.6.1
  • EC 3.6.4.13
  • helicase like protein 2
  • Helicase-like protein 2
  • HLP2ATP-dependent RNA helicase DDX3X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00054606-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-351
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61745
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2030
Species: Hu
Applications: WB, IHC
NBP1-90978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80628
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DDX3 Antibody (NBP1-85291)(3)

Reviews for DDX3 Antibody (NBP1-85291) (0)

There are no reviews for DDX3 Antibody (NBP1-85291). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX3 Antibody (NBP1-85291) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX3 Products

Bioinformatics Tool for DDX3 Antibody (NBP1-85291)

Discover related pathways, diseases and genes to DDX3 Antibody (NBP1-85291). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX3 Antibody (NBP1-85291)

Discover more about diseases related to DDX3 Antibody (NBP1-85291).
 

Pathways for DDX3 Antibody (NBP1-85291)

View related products by pathway.

PTMs for DDX3 Antibody (NBP1-85291)

Learn more about PTMs related to DDX3 Antibody (NBP1-85291).
 

Research Areas for DDX3 Antibody (NBP1-85291)

Find related products by research area.

Blogs on DDX3

There are no specific blogs for DDX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX3X