DAK Antibody - BSA Free

Western Blot: DAK Antibody [NBP1-84142] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: DAK Antibody [NBP1-84142] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Staining of human kidney, liver, skeletal muscle and upper gastrointestinal using Anti-TKFC antibody NBP1-84142 (A) shows similar protein distribution across tissues to independent antibody NBP2-48894 (B).

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DAK Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DAK Protein (NBP1-84142PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DAK Antibody - BSA Free

• ATP-dependent dihydroxyacetone kinase
• bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
• DHA kinase
• Dha kinase/FMN cyclase
• dihydroxyacetone kinase 2 homolog (S. cerevisiae)
• dihydroxyacetone kinase 2 homolog (yeast)
• DKFZP586B1621
• FAD-AMP lyase cyclic FMN forming
• FAD-AMP lyase cyclizing
• glycerone kinase
• MGC5621
• NET45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DAK