Cytokeratin 14 Antibody


Western Blot: Cytokeratin 14 Antibody [NBP1-84917] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA more
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody [NBP1-84917] - Staining in human skin and duodenum tissues using anti-KRT14 antibody. Corresponding KRT14 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody [NBP1-84917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody [NBP1-84917] - Staining of human skin shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Cytokeratin 14 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Specificity of human Cytokeratin 14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytokeratin 14 Protein (NBP1-84917PEP)

Reactivity Notes

Mouse (88%), Rat (88%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cytokeratin 14 Antibody

  • CK14
  • CK-14
  • Cytokeratin 14
  • cytokeratin-14
  • EBS3
  • EBS4
  • K14
  • keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner)
  • keratin 14
  • keratin, type I cytoskeletal 14
  • keratin-14
  • KRT14
  • NFJ


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Rb, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytokeratin 14 Antibody (NBP1-84917) (0)

There are no publications for Cytokeratin 14 Antibody (NBP1-84917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 14 Antibody (NBP1-84917) (0)

There are no reviews for Cytokeratin 14 Antibody (NBP1-84917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytokeratin 14 Antibody (NBP1-84917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytokeratin 14 Products

Bioinformatics Tool for Cytokeratin 14 Antibody (NBP1-84917)

Discover related pathways, diseases and genes to Cytokeratin 14 Antibody (NBP1-84917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 14 Antibody (NBP1-84917)

Discover more about diseases related to Cytokeratin 14 Antibody (NBP1-84917).

Pathways for Cytokeratin 14 Antibody (NBP1-84917)

View related products by pathway.

PTMs for Cytokeratin 14 Antibody (NBP1-84917)

Learn more about PTMs related to Cytokeratin 14 Antibody (NBP1-84917).

Research Areas for Cytokeratin 14 Antibody (NBP1-84917)

Find related products by research area.

Blogs on Cytokeratin 14

There are no specific blogs for Cytokeratin 14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytokeratin 14 Antibody and receive a gift card or discount.


Gene Symbol KRT14