Cytochrome p450 2J2 Antibody (2D10)

Images

 
Western Blot: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - analysis of CYP2J2 expression in transfected 293T cell line by CYP2J2 monoclonal antibody (M01), clone 2D10. Lane 1: CYP2J2 transfected lysate (58 ...read more
Western Blot: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - CYP2J2 monoclonal antibody (M01), clone 2D10 Western Blot analysis of CYP2J2 expression in HepG2 ( Cat # L019V1 ).
ELISA: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - Detection limit for recombinant GST tagged CYP2J2 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cytochrome p450 2J2 Antibody (2D10) Summary

Immunogen
CYP2J2 (NP_000766, 408 a.a. - 498 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Specificity
CYP2J2 - cytochrome P450, family 2, subfamily J, polypeptide 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CYP2J2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publications using H00001573-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytochrome p450 2J2 Antibody (2D10)

  • Arachidonic acid epoxygenase
  • CPJ2
  • CYPIIJ2
  • cytochrome P450 2J2
  • cytochrome P450, family 2, subfamily J, polypeptide 2
  • cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • microsomal monooxygenase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-24722
Species: Hu
Applications: WB, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP

Publications for Cytochrome p450 2J2 Antibody (H00001573-M01)(4)

Reviews for Cytochrome p450 2J2 Antibody (H00001573-M01) (0)

There are no reviews for Cytochrome p450 2J2 Antibody (H00001573-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome p450 2J2 Antibody (H00001573-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome p450 2J2 Products

Bioinformatics Tool for Cytochrome p450 2J2 Antibody (H00001573-M01)

Discover related pathways, diseases and genes to Cytochrome p450 2J2 Antibody (H00001573-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome p450 2J2 Antibody (H00001573-M01)

Discover more about diseases related to Cytochrome p450 2J2 Antibody (H00001573-M01).
 

Pathways for Cytochrome p450 2J2 Antibody (H00001573-M01)

View related products by pathway.

PTMs for Cytochrome p450 2J2 Antibody (H00001573-M01)

Learn more about PTMs related to Cytochrome p450 2J2 Antibody (H00001573-M01).
 

Research Areas for Cytochrome p450 2J2 Antibody (H00001573-M01)

Find related products by research area.

Blogs on Cytochrome p450 2J2

There are no specific blogs for Cytochrome p450 2J2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome p450 2J2 Antibody (2D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2J2
Entrez
OMIM
Uniprot