Cystatin E/M/CST6 Antibody

Images

 
Western Blot: CST6 Antibody [NBP1-69005] - Mouse Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cystatin E/M/CST6 Antibody Summary

Immunogen
Synthetic peptides corresponding to Cst6 (cystatin E/M) The peptide sequence was selected from the middle region of Cst6. Peptide sequence CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CST6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Cst6 and was validated on Western blot.
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cystatin E/M/CST6 Antibody

  • CST6
  • cystatin 6
  • Cystatin E/M
  • cystatin M
  • cystatin M/E
  • Cystatin-6
  • cystatin-E
  • cystatin-M
  • cysteine proteinase inhibitor

Background

The function of Cst6 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF2199
Species: Hu
Applications: WB, IP
1407-PI
Species: Hu
AF1013
Species: Mu
Applications: WB, IHC, IP
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
MAB1080
Species: Hu
Applications: WB, IHC, IP
MAB1296
Species: Hu
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
MAB1569
Species: Hu
Applications: WB, IHC, IP
AF1029
Species: Mu
Applications: WB, IHC, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
1407-PI
Species: Hu
NBP2-45562
Species: Hu
Applications: WB, Flow, IHC
AF4604
Species: Hu
Applications: WB, IHC
NBP1-69005
Species: Mu
Applications: WB

Publications for Cystatin E/M/CST6 Antibody (NBP1-69005) (0)

There are no publications for Cystatin E/M/CST6 Antibody (NBP1-69005).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin E/M/CST6 Antibody (NBP1-69005) (0)

There are no reviews for Cystatin E/M/CST6 Antibody (NBP1-69005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cystatin E/M/CST6 Antibody (NBP1-69005) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin E/M/CST6 Products

Bioinformatics Tool for Cystatin E/M/CST6 Antibody (NBP1-69005)

Discover related pathways, diseases and genes to Cystatin E/M/CST6 Antibody (NBP1-69005). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin E/M/CST6 Antibody (NBP1-69005)

Discover more about diseases related to Cystatin E/M/CST6 Antibody (NBP1-69005).
 

Pathways for Cystatin E/M/CST6 Antibody (NBP1-69005)

View related products by pathway.

PTMs for Cystatin E/M/CST6 Antibody (NBP1-69005)

Learn more about PTMs related to Cystatin E/M/CST6 Antibody (NBP1-69005).

Blogs on Cystatin E/M/CST6

There are no specific blogs for Cystatin E/M/CST6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin E/M/CST6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CST6
Entrez
Uniprot