Transglutaminase 3/TGM3 Antibody

Images

 
Western Blot: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Transglutaminase 3/TGM3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQEPSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSATMSLDPEEEAEHPIKISYAQYEKYLKSDNMI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Transglutaminase 3/TGM3 Protein (NBP1-86950PEP)
Publications
Read Publication using NBP1-86950.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transglutaminase 3/TGM3 Antibody

  • EC 2.3.2.13
  • MGC126250
  • protein-glutamine gamma-glutamyltransferase E
  • TG(E)
  • TG3
  • TGase E
  • TGase-3
  • TgaseE
  • TGEMGC126249
  • TGM3
  • transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase)
  • Transglutaminase 3
  • Transglutaminase E
  • transglutaminase-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45562
Species: Hu
Applications: WB, Flow, IHC
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-54329
Species: Hu
Applications: WB
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
AF5426
Species: Hu
Applications: WB
NBP1-84437
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-14942
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1080
Species: Hu
Applications: WB, IHC, IP
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF2199
Species: Hu
Applications: WB, IP
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3607
Species: Hu
Applications: WB
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-86950
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Transglutaminase 3/TGM3 Antibody (NBP1-86950)(1)

Reviews for Transglutaminase 3/TGM3 Antibody (NBP1-86950) (0)

There are no reviews for Transglutaminase 3/TGM3 Antibody (NBP1-86950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Transglutaminase 3/TGM3 Antibody (NBP1-86950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Transglutaminase 3/TGM3 Products

Bioinformatics Tool for Transglutaminase 3/TGM3 Antibody (NBP1-86950)

Discover related pathways, diseases and genes to Transglutaminase 3/TGM3 Antibody (NBP1-86950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transglutaminase 3/TGM3 Antibody (NBP1-86950)

Discover more about diseases related to Transglutaminase 3/TGM3 Antibody (NBP1-86950).
 

Pathways for Transglutaminase 3/TGM3 Antibody (NBP1-86950)

View related products by pathway.

PTMs for Transglutaminase 3/TGM3 Antibody (NBP1-86950)

Learn more about PTMs related to Transglutaminase 3/TGM3 Antibody (NBP1-86950).

Blogs on Transglutaminase 3/TGM3

There are no specific blogs for Transglutaminase 3/TGM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Transglutaminase 3/TGM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TGM3
Entrez