Transglutaminase 3/TGM3 Antibody

Western Blot: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Analysis in human cell line EFO-21.

Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining of human stomach shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Analysis in human esophagus and stomach tissues. Corresponding Transglutaminase 3/TGM3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining of human lymph node shows no positivity in germinal center cells and non-germinal center cells as expected.

Immunohistochemistry-Paraffin: Transglutaminase 3/TGM3 Antibody [NBP1-86950] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Transglutaminase 3/TGM3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQEPSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSATMSLDPEEEAEHPIKISYAQYEKYLKSDNMI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGM3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Transglutaminase 3/TGM3 Protein (NBP1-86950PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Transglutaminase 3/TGM3 Antibody

• EC 2.3.2.13
• MGC126250
• protein-glutamine gamma-glutamyltransferase E
• TG(E)
• TG3
• TGase E
• TGase-3
• TgaseE
• TGEMGC126249
• TGM3
• transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase)
• Transglutaminase 3
• Transglutaminase E
• transglutaminase-3

Background

Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium dependent. Transglutaminase 3 consists of two polypeptide chains activated from a single precursor protein by proteolysis. Transglutaminase 3 is involved the later stages of cell envelope formation in the epidermis and hair follicle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Transglutaminase 3/TGM3 Antibody (NBP1-86950)(1)

Publication using NBP1-86950

• Uemura N, Nakanishi Y, Kato H et al. Transglutaminase 3 as a prognostic biomarker in esophageal cancer revealed by proteomics. Int J Cancer 2009-05-01 [PMID: 19142970]

Bioinformatics

• Gene Symbol: TGM3