CYP7B1 Antibody (2B11) - Azide and BSA Free

Western Blot: CYP7B1 Antibody (2B11) [H00009420-M06] - Analysis of CYP7B1 expression in transfected 293T cell line by CYP7B1 monoclonal antibody (M06), clone 2B11. Lane 1: CYP7B1 transfected lysatE (58.256 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: CYP7B1 Antibody (2B11) [H00009420-M06] - Analysis of monoclonal antibody to CYP7B1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml

ELISA: CYP7B1 Antibody (2B11) [H00009420-M06] - Detection limit for recombinant GST tagged CYP7B1 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 2B11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CYP7B1 Antibody (2B11) - Azide and BSA Free Summary

• Immunogen: CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH
• Specificity: CYP7B1 - cytochrome P450, family 7, subfamily B, polypeptide 1 (2B11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CYP7B1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYP7B1 Antibody (2B11) - Azide and BSA Free

• CBAS3
• CP7B
• Cytochrome P450 7B1
• cytochrome P450, family 7, subfamily B, polypeptide 1
• cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase
• EC 1.14.13.100
• Oxysterol 7-alpha-hydroxylase
• oxysterol 7alpha-hydroxylase
• spastic paraplegia 5A (autosomal recessive)
• SPG5A

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYP7B1
• Entrez:
  • 9420(Human)
• Uniprot:
  • NP_004811(Human)