CYP7B1 Antibody (2B11)


Western Blot: CYP7B1 Antibody (2B11) [H00009420-M06] - Analysis of CYP7B1 expression in transfected 293T cell line by CYP7B1 monoclonal antibody (M06), clone 2B11. Lane 1: CYP7B1 transfected lysatE (58.256 KDa). Lane 2: more
Immunohistochemistry-Paraffin: CYP7B1 Antibody (2B11) [H00009420-M06] - Analysis of monoclonal antibody to CYP7B1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
ELISA: CYP7B1 Antibody (2B11) [H00009420-M06] - Detection limit for recombinant GST tagged CYP7B1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC

Order Details

CYP7B1 Antibody (2B11) Summary

CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH
CYP7B1 - cytochrome P450, family 7, subfamily B, polypeptide 1 (2B11)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYP7B1 Antibody (2B11)

  • CBAS3
  • CP7B
  • Cytochrome P450 7B1
  • cytochrome P450, family 7, subfamily B, polypeptide 1
  • cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase
  • EC
  • Oxysterol 7-alpha-hydroxylase
  • oxysterol 7alpha-hydroxylase
  • spastic paraplegia 5A (autosomal recessive)
  • SPG5A


This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: DirELISA, IP, WB

Publications for CYP7B1 Antibody (H00009420-M06) (0)

There are no publications for CYP7B1 Antibody (H00009420-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP7B1 Antibody (H00009420-M06) (0)

There are no reviews for CYP7B1 Antibody (H00009420-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP7B1 Antibody (H00009420-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CYP7B1 Products

Diseases for CYP7B1 Antibody (H00009420-M06)

Discover more about diseases related to CYP7B1 Antibody (H00009420-M06).

Pathways for CYP7B1 Antibody (H00009420-M06)

View related products by pathway.

PTMs for CYP7B1 Antibody (H00009420-M06)

Learn more about PTMs related to CYP7B1 Antibody (H00009420-M06).

Research Areas for CYP7B1 Antibody (H00009420-M06)

Find related products by research area.

Blogs on CYP7B1

There are no specific blogs for CYP7B1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CYP7B1 Antibody (2B11) and receive a gift card or discount.


Gene Symbol CYP7B1