CYP7B1 Antibody (2B11)

Images

 
Western Blot: CYP7B1 Antibody (2B11) [H00009420-M06] - Analysis of CYP7B1 expression in transfected 293T cell line by CYP7B1 monoclonal antibody (M06), clone 2B11. Lane 1: CYP7B1 transfected lysatE (58.256 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: CYP7B1 Antibody (2B11) [H00009420-M06] - Analysis of monoclonal antibody to CYP7B1 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
ELISA: CYP7B1 Antibody (2B11) [H00009420-M06] - Detection limit for recombinant GST tagged CYP7B1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
2B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CYP7B1 Antibody (2B11) Summary

Immunogen
CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH
Specificity
CYP7B1 - cytochrome P450, family 7, subfamily B, polypeptide 1 (2B11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CYP7B1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYP7B1 Antibody (2B11)

  • CBAS3
  • CP7B
  • Cytochrome P450 7B1
  • cytochrome P450, family 7, subfamily B, polypeptide 1
  • cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase
  • EC 1.14.13.100
  • Oxysterol 7-alpha-hydroxylase
  • oxysterol 7alpha-hydroxylase
  • spastic paraplegia 5A (autosomal recessive)
  • SPG5A

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76827
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB9120
Species: Hu
Applications: ICC
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NB200-305
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-68884
Species: Hu
Applications: WB
NBP2-50206
Species: Hu
Applications: ELISA, IHC, WB
MAB8924
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP3-10145
Species: Mu
Applications: WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB

Publications for CYP7B1 Antibody (H00009420-M06) (0)

There are no publications for CYP7B1 Antibody (H00009420-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP7B1 Antibody (H00009420-M06) (0)

There are no reviews for CYP7B1 Antibody (H00009420-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP7B1 Antibody (H00009420-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP7B1 Products

Bioinformatics Tool for CYP7B1 Antibody (H00009420-M06)

Discover related pathways, diseases and genes to CYP7B1 Antibody (H00009420-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP7B1 Antibody (H00009420-M06)

Discover more about diseases related to CYP7B1 Antibody (H00009420-M06).
 

Pathways for CYP7B1 Antibody (H00009420-M06)

View related products by pathway.

PTMs for CYP7B1 Antibody (H00009420-M06)

Learn more about PTMs related to CYP7B1 Antibody (H00009420-M06).

Blogs on CYP7B1

There are no specific blogs for CYP7B1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP7B1 Antibody (2B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP7B1
Entrez
Uniprot