CYP51A1 Antibody - BSA Free

Western Blot: CYP51A1 Antibody [NBP3-38236] - Western blot analysis of various lysates, using CYP51A1 Rabbit pAb at 1:800 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CYP51A1 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-509 of CYP51A1 (NP_000777.1).
  
  Sequence:
  LTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYP51A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CYP51A1 Antibody - BSA Free

• CP51
• CYP51
• CYP51A1
• CYP51Cytochrome P450LI
• CYPL1
• CYPLI
• Cytochrome P450 51A1
• cytochrome P450, family 51, subfamily A, polypeptide 1
• Cytochrome P45014DM
• Cytochrome P450-14DM
• Cytochrome P450LI
• EC 1.14.13.70
• EC 1.14.14.154
• lanosterol 14-alpha demethylase
• lanosterol 14-alpha-demethylase
• LDM
• LDMCytochrome P45014DM
• P450-14DM
• P450L1,51 (lanosterol 14-alpha-demethylase)
• Sterol 14-alpha demethylase

Background

CYP51A1, also known as Lanosterol 14-alpha demethylase, consists of a 56.8 kDa and a 46.3 kDa isoform and is involved in transforming lanosterol by removing the 14alpha-methyl group. Current research is being conducted with several diseases including tuberculosis, antley-bixler syndrome, colorectal cancer, leukemia, immunodeficiency, prostatitis, cholesterol, and chagas disease. This protein has been linked to the cholesterol and steroid biosynthesis, metabolism, and signaling pathways, where it interacts with FA2H, MSMO1, SCD, ZMPSTE24, and FDFT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYP51A1