CYP11B2 Antibody

Images

 
Western Blot: CYP11B2 Antibody [NBP2-87238] - Host: Rabbit. Target Name: CYP11B2. Sample Tissue: Human Stomach Tumor. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP11B2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human CYP11B2. Peptide sequence: FEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CYP11B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP11B2 Antibody

  • ALDOSCYP11B
  • Aldosterone synthase
  • Aldosterone-synthesizing enzyme
  • CPN2
  • CYP11BL
  • CYPXIB2
  • cytochrome P450 11B2, mitochondrial
  • cytochrome P450, family 11, subfamily B, polypeptide 2
  • cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2
  • Cytochrome P-450Aldo
  • Cytochrome P-450C18
  • EC 1.14.15
  • EC 1.14.15.4
  • EC 1.14.15.5
  • mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2
  • P450aldo
  • P450C18
  • P-450C18
  • steroid 11-beta/18-hydroxylase
  • steroid 11-beta-monooxygenase
  • Steroid 18-hydroxylase
  • steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-68883
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77078
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DAN00
Species: Hu
Applications: ELISA
NBP2-13893
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89200
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
AF7895
Species: Hu
Applications: IHC, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-33485
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37898
Species: Hu
Applications: IHC, IHC-P, WB
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-87238
Species: Hu
Applications: WB

Publications for CYP11B2 Antibody (NBP2-87238) (0)

There are no publications for CYP11B2 Antibody (NBP2-87238).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP11B2 Antibody (NBP2-87238) (0)

There are no reviews for CYP11B2 Antibody (NBP2-87238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP11B2 Antibody (NBP2-87238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP11B2 Products

Bioinformatics Tool for CYP11B2 Antibody (NBP2-87238)

Discover related pathways, diseases and genes to CYP11B2 Antibody (NBP2-87238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11B2 Antibody (NBP2-87238)

Discover more about diseases related to CYP11B2 Antibody (NBP2-87238).
 

Pathways for CYP11B2 Antibody (NBP2-87238)

View related products by pathway.

PTMs for CYP11B2 Antibody (NBP2-87238)

Learn more about PTMs related to CYP11B2 Antibody (NBP2-87238).
 

Research Areas for CYP11B2 Antibody (NBP2-87238)

Find related products by research area.

Blogs on CYP11B2

There are no specific blogs for CYP11B2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP11B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP11B2