Cyclin I Antibody

Images

 
Western Blot: Cyclin I Antibody [NBP2-56916] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: Cyclin I Antibody [NBP2-56916] - Staining of human cell line MCF7 shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclin I Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLH
Specificity
Specificity of human Cyclin I antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNI
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
Cyclin I Knockout 293T Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Cyclin I Antibody

  • CYC1
  • cyclin I
  • cyclin ITI
  • cyclin-I
  • CYI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-45217
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, PEP-ELISA
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-19533
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5447
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-75398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00001594-Q01
Species: Hu
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-19535
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, ChIP
AF7250
Species: Hu
Applications: IHC

Publications for Cyclin I Antibody (NBP2-56916) (0)

There are no publications for Cyclin I Antibody (NBP2-56916).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin I Antibody (NBP2-56916) (0)

There are no reviews for Cyclin I Antibody (NBP2-56916). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cyclin I Antibody (NBP2-56916) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cyclin I Products

Bioinformatics Tool for Cyclin I Antibody (NBP2-56916)

Discover related pathways, diseases and genes to Cyclin I Antibody (NBP2-56916). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin I Antibody (NBP2-56916)

Discover more about diseases related to Cyclin I Antibody (NBP2-56916).
 

Pathways for Cyclin I Antibody (NBP2-56916)

View related products by pathway.

PTMs for Cyclin I Antibody (NBP2-56916)

Learn more about PTMs related to Cyclin I Antibody (NBP2-56916).

Blogs on Cyclin I

There are no specific blogs for Cyclin I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclin I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNI