Cyclin I Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cyclin I Antibody [NBP2-34060] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry: Cyclin I Antibody [NBP2-34060] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclin I Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNV
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cyclin I Protein (NBP2-34060PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cyclin I Antibody

  • CYC1
  • cyclin I
  • cyclin ITI
  • cyclin-I
  • CYI

Background

The protein encoded by the Cyclin gene belongs to the highly conserved cyclin family, whose members are characterized by adramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases.Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordinationof each mitotic event. This cyclin shows the highest similarity with cyclin G. The transcript of this gene was foundto be expressed constantly during cell cycle progression. The function of this cyclin has not yet been determined.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cyclin I Antibody (NBP2-34060) (0)

There are no publications for Cyclin I Antibody (NBP2-34060).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin I Antibody (NBP2-34060) (0)

There are no reviews for Cyclin I Antibody (NBP2-34060). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cyclin I Antibody (NBP2-34060) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclin I Products

Research Areas for Cyclin I Antibody (NBP2-34060)

Find related products by research area.

Blogs on Cyclin I

There are no specific blogs for Cyclin I, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclin I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNI
Uniprot