Recombinant Human CXCR4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CXCR4 Protein [H00007852-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human CXCR4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-46 of Human CXCR4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CXCR4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
30.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CXCR4 GST (N-Term) Protein

  • CD184
  • chemokine (C-X-C motif) receptor 4
  • chemokine (C-X-C motif), receptor 4 (fusin)
  • C-X-C chemokine receptor type 4
  • CXCR4
  • CXC-R4
  • CXCR-4
  • D2S201E
  • D2S201ESDF-1 receptor
  • FB22
  • Fusin
  • HM89
  • HM89NPYRL
  • HSY3RR
  • LAP3
  • LAP-3
  • LCR1
  • LESTR
  • LESTRCD184 antigen
  • Leukocyte-derived seven transmembrane domain receptor
  • leukocyte-derived seven-transmembrane-domain receptor
  • lipopolysaccharide-associated protein 3
  • neuropeptide Y receptor Y3
  • NPY3R
  • NPY3RWHIM
  • NPYR
  • NPYRL
  • NPYY3R
  • pCXCR4
  • seven transmembrane helix receptor
  • seven-transmembrane-segment receptor, spleen
  • Stromal cell-derived factor 1 receptor
  • WHIMS

Background

CXCR4 - chemokine (C-X-C motif) receptor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

350-NS
Species: Fe, Hu, RM
Applications: BA, BA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
DVE00
Species: Hu
Applications: ELISA
DRN00B
Species: Hu
Applications: ELISA
MAB155
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
MAB197
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
MAB145
Species: Hu
Applications: CyTOF-ready, Flow
DCP00
Species: Hu
Applications: ELISA

Publications for CXCR4 Partial Recombinant Protein (H00007852-Q01) (0)

There are no publications for CXCR4 Partial Recombinant Protein (H00007852-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCR4 Partial Recombinant Protein (H00007852-Q01) (0)

There are no reviews for CXCR4 Partial Recombinant Protein (H00007852-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCR4 Partial Recombinant Protein (H00007852-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Which is your best CXCR4 for immunohistochemistry in paraffin tissues? I would like to detect it in paraffin embedded tissues from human breast cancer samples.
    • CXCR4 antibody (NB100-74396) is our best selling product among all the CXCR4 antibodies and it has been validated for IHC-P in human cervical carcinoma tissue sections. NB100-74396 has been cited in at least 7 research publications. Additionally, here is a list of all of our CXCR4 antibodies that has been verified in IHC-P in human samples.

Additional CXCR4 Products

Research Areas for CXCR4 Partial Recombinant Protein (H00007852-Q01)

Find related products by research area.

Blogs on CXCR4.

Stemness is responsible for onset and metastasis of colorectal cancer
By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C...  Read full blog post.

LAMP2: Protector of the lysosome
LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m...  Read full blog post.

CXCR4 Studies on Neural and Stem Cells
The CXCR4 (C-X-C chemokine receptor type 4) protein is one member of the G-protein coupled receptor (GPCR1) family. As a multipass membrane protein that is found in several tissues, it is the receptor for the C-X-C chemokine CXCL12/SDF-1. The CXCR4 li...  Read full blog post.

Understanding CXCR4 and SDF1
CXCR4 (C-X-C chemokine receptor type 4) is a member of the G-protein coupled receptor (GPCR1) family. It is expressed as a multipass membrane protein in several tissues where it acts as the receptor for the C-X-C chemokine CXCL12/SDF-1. This ligand in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CXCR4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCR4