CXCL12/SDF-1 Antibody (4D8)

Images

 
Sandwich ELISA: CXCL12/SDF-1 Antibody (4D8) [H00006387-M06] - Detection limit for recombinant GST tagged CXCL12 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CXCL12/SDF-1 Antibody (4D8) Summary

Immunogen
CXCL12 (AAH39893.1, 1 a.a. - 89 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Specificity
CXCL12 - chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CXCL12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL12/SDF-1 Antibody (4D8)

  • chemokine (C-X-C motif) ligand 12
  • C-X-C motif chemokine 12
  • CXCL12
  • hIRH
  • hSDF-1
  • Intercrine reduced in hepatomas
  • IRH
  • PBSF
  • PBSFSDF-1a
  • Pre-B cell growth-stimulating factor
  • SCYB12
  • SDF1
  • SDF-1
  • SDF1A
  • SDF1B
  • SDF1SDF-1b
  • stromal cell-derived factor 1
  • TLSF
  • TLSF-a
  • TLSF-b
  • TPAR1

Background

For background information on chemokines, see CXCL11 (SCYB11; MIM 604852). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24779
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
366-6C/CF
Species: Hu
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF470
Species: Mu
Applications: WB, IHC, Neut
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006387-M06
Species: Hu
Applications: ELISA

Publications for CXCL12/SDF-1 Antibody (H00006387-M06) (0)

There are no publications for CXCL12/SDF-1 Antibody (H00006387-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL12/SDF-1 Antibody (H00006387-M06) (0)

There are no reviews for CXCL12/SDF-1 Antibody (H00006387-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CXCL12/SDF-1 Antibody (H00006387-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL12/SDF-1 Products

Bioinformatics Tool for CXCL12/SDF-1 Antibody (H00006387-M06)

Discover related pathways, diseases and genes to CXCL12/SDF-1 Antibody (H00006387-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL12/SDF-1 Antibody (H00006387-M06)

Discover more about diseases related to CXCL12/SDF-1 Antibody (H00006387-M06).
 

Pathways for CXCL12/SDF-1 Antibody (H00006387-M06)

View related products by pathway.

PTMs for CXCL12/SDF-1 Antibody (H00006387-M06)

Learn more about PTMs related to CXCL12/SDF-1 Antibody (H00006387-M06).
 

Research Areas for CXCL12/SDF-1 Antibody (H00006387-M06)

Find related products by research area.

Blogs on CXCL12/SDF-1

There are no specific blogs for CXCL12/SDF-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL12/SDF-1 Antibody (4D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCL12
Entrez
OMIM
Uniprot