CX3CR1 Recombinant Protein Antigen

Images

 
There are currently no images for CX3CR1 Recombinant Protein Antigen (NBP2-69050PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CX3CR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CX3CR1.

Source: E. coli

Amino Acid Sequence: HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CX3CR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-69050.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CX3CR1 Recombinant Protein Antigen

  • Beta chemokine receptor-like 1
  • CCRL1
  • chemokine (C-C) receptor-like 1
  • chemokine (C-X3-C motif) receptor 1
  • chemokine (C-X3-C) receptor 1
  • CMKbRL1
  • CMK-BRL1
  • CMK-BRL-1
  • CMKDR1
  • CX3C chemokine receptor 1
  • CX3CR1
  • Fractalkine receptor
  • G protein-coupled receptor 13
  • GPR13G-protein coupled receptor 13
  • GPRV28
  • V28
  • V28C-X3-C CKR-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB150
Species: Hu
Applications: CyTOF-ready, Flow, IHC
DCP00
Species: Hu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DRN00B
Species: Hu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DY417
Species: Mu
Applications: ELISA
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
7268-CT
Species: Hu
Applications: BA
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
M6000B
Species: Mu
Applications: ELISA
MAB145
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
MAB155
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP2-69050PEP
Species: Hu
Applications: AC

Publications for CX3CR1 Recombinant Protein Antigen (NBP2-69050PEP) (0)

There are no publications for CX3CR1 Recombinant Protein Antigen (NBP2-69050PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CX3CR1 Recombinant Protein Antigen (NBP2-69050PEP) (0)

There are no reviews for CX3CR1 Recombinant Protein Antigen (NBP2-69050PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CX3CR1 Recombinant Protein Antigen (NBP2-69050PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CX3CR1 Products

Research Areas for CX3CR1 Recombinant Protein Antigen (NBP2-69050PEP)

Find related products by research area.

Blogs on CX3CR1.

TMEM 119 is a specific marker of microglia cells
By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra...  Read full blog post.

New Study Links Tau Mutations to Microglial Immune Response
Tau proteins are abundant in the axons of neurons in the central nervous system (CNS), and play a key role in microtubule formation and stabilization. Antibody studies have identified six tau isoforms, all produced by alternative mRNA splicing of the ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CX3CR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CX3CR1