Reactivity | HuSpecies Glossary |
Applications | ICC/IF |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | CX3CR1 (NP_001328.1, 1 a.a. - 355 a.a.) full-length human protein. MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL |
Specificity | Reacts with chemokine (C-X3-C motif) receptor 1. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | CX3CR1 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00001524-B01P | Applications | Species |
---|---|---|
Sellgren C, Sheridan S, Grcias J Patient-specific models of microglia-mediated engulfment of synapses and neural progenitors Mol. Psychiatry, 2016-12-13;0(0):. 2016-12-13 [PMID: 27956744] |
Secondary Antibodies |
Isotype Controls |
Research Areas for CX3CR1 Antibody (H00001524-B01P)Find related products by research area.
|
TMEM 119 is a specific marker of microglia cells By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra... Read full blog post. |
New Study Links Tau Mutations to Microglial Immune Response Tau proteins are abundant in the axons of neurons in the central nervous system (CNS), and play a key role in microtubule formation and stabilization. Antibody studies have identified six tau isoforms, all produced by alternative mRNA splicing of the ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CX3CR1 |
Entrez |
|
Uniprot |
|