CX3CL1/Fractalkine Antibody

Images

 
Immunohistochemistry: CX3CL1/Fractalkine Antibody [NBP1-89309] - Staining of human colon shows strong cytoplasmic positivity with granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CX3CL1/Fractalkine Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CX3CL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CX3CL1/Fractalkine Protein (NBP1-89309PEP)
Publications
Read Publication using
NBP1-89309 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CX3CL1/Fractalkine Antibody

  • ABCD-3
  • C3Xkine
  • chemokine (C-X3-C motif) ligand 1
  • CX3C membrane-anchored chemokine
  • CX3CL1
  • CXC3
  • CXC3C
  • FKN
  • Fractalkine
  • Neurotactin
  • neurotactin)
  • NTNsmall inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine
  • NTTSmall-inducible cytokine D1
  • SCYD1C-X3-C motif chemokine 1
  • small inducible cytokine subfamily D (Cys-X3-Cys), member-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76949
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF482
Species: Mu
Applications: WB, IHC
NBP1-89309
Species: Hu
Applications: IHC, IHC-P

Publications for CX3CL1/Fractalkine Antibody (NBP1-89309)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CX3CL1/Fractalkine Antibody (NBP1-89309) (0)

There are no reviews for CX3CL1/Fractalkine Antibody (NBP1-89309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CX3CL1/Fractalkine Antibody (NBP1-89309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CX3CL1/Fractalkine Products

Bioinformatics Tool for CX3CL1/Fractalkine Antibody (NBP1-89309)

Discover related pathways, diseases and genes to CX3CL1/Fractalkine Antibody (NBP1-89309). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CX3CL1/Fractalkine Antibody (NBP1-89309)

Discover more about diseases related to CX3CL1/Fractalkine Antibody (NBP1-89309).
 

Pathways for CX3CL1/Fractalkine Antibody (NBP1-89309)

View related products by pathway.

PTMs for CX3CL1/Fractalkine Antibody (NBP1-89309)

Learn more about PTMs related to CX3CL1/Fractalkine Antibody (NBP1-89309).
 

Research Areas for CX3CL1/Fractalkine Antibody (NBP1-89309)

Find related products by research area.

Blogs on CX3CL1/Fractalkine

There are no specific blogs for CX3CL1/Fractalkine, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CX3CL1/Fractalkine Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CX3CL1
Entrez