CTRP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CTRP2 Antibody [NBP2-34139] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus & centrosome.

Immunohistochemistry-Paraffin: CTRP2 Antibody [NBP2-34139] - Staining of human uterus, pre-menopause shows strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CTRP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AAEESRDAEPRRELLCSGRPWTWRAAARVTTMIPWVLLACALPCAADPLLGASARRDFRKGSPQLVCSLPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C1QTNF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CTRP2 Protein (NBP2-34139PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CTRP2 Antibody - BSA Free

• C1q and tumor necrosis factor related protein 2
• C1QTNF2
• complement-c1q tumor necrosis factor-related protein 2
• CTRP2
• CTRP2complement C1q tumor necrosis factor-related protein 2
• zacrp2

Background

CTRP2 (C1q and tumor necrosis factor related protein 2 or C1QTNF2) is a secreted 285 amino acid protein. CTRP2 may regulate glycogen, fatty acids, D-glucose and oleic acid.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C1QTNF2
• Uniprot:
  • Q9BXJ5()