WDR77 Antibody


Western Blot: WDR77 Antibody [NBP1-82778] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: WDR77 Antibody [NBP1-82778] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: WDR77 Antibody [NBP1-82778] - Staining of human fallopian tube shows cytoplasmic and nuclear positivity in glandular cells.
Western Blot: WDR77 Antibody [NBP1-82778] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

WDR77 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SEDCSIAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE
Specificity of human, mouse, rat WDR77 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDR77 Protein (NBP1-82778PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for WDR77 Antibody

  • Androgen receptor cofactor p44
  • MEP-50
  • MEP50Nbla10071
  • methylosome protein 50
  • MGC2722
  • p44
  • p44/Mep50
  • RP11-552M11.3
  • WD repeat domain 77
  • WD repeat-containing protein 77


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WDR77 Antibody (NBP1-82778) (0)

There are no publications for WDR77 Antibody (NBP1-82778).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR77 Antibody (NBP1-82778) (0)

There are no reviews for WDR77 Antibody (NBP1-82778). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WDR77 Antibody (NBP1-82778). (Showing 1 - 1 of 1 FAQ).

  1. I have seen that the peptide from which was raised the antibody NBP1-82778 is 85% homologous in mice. My question is: is this antibody working for IHC also in mouse or not?
    • NBP1-82778 has never been tested in mouse, however, since the immunogen shares 88% similarity with mouse, it is predicted to cross-react since it is a polyclonal antibody. You would be glad to learn that for untested species or applications, we offer our Innovator's Reward program. When you submit a review of your experiment, we will supply you with a credit for the purchase price of the antibody. Contact us for more information at innovators@novusbio.com.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for WDR77 Antibody (NBP1-82778)

Discover related pathways, diseases and genes to WDR77 Antibody (NBP1-82778). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR77 Antibody (NBP1-82778)

Discover more about diseases related to WDR77 Antibody (NBP1-82778).

Pathways for WDR77 Antibody (NBP1-82778)

View related products by pathway.

PTMs for WDR77 Antibody (NBP1-82778)

Learn more about PTMs related to WDR77 Antibody (NBP1-82778).

Research Areas for WDR77 Antibody (NBP1-82778)

Find related products by research area.

Blogs on WDR77

There are no specific blogs for WDR77, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WDR77 Antibody and receive a gift card or discount.


Gene Symbol WDR77