IFI44 Antibody


Immunocytochemistry/ Immunofluorescence: IFI44 Antibody [NBP2-55064] - Staining of human cell line HeLa shows localization to nucleoplasm.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

IFI44 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDSMDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELD
Specificity of human IFI44 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFI44 Recombinant Protein Antigen (NBP2-55064PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for IFI44 Antibody

  • interferon-induced protein 44
  • interferon-induced, hepatitis C-associated microtubular aggregate protein(44kD)
  • MTAP44p44Microtubule-associated protein 44
  • P44


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IFI44 Antibody (NBP2-55064) (0)

There are no publications for IFI44 Antibody (NBP2-55064).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFI44 Antibody (NBP2-55064) (0)

There are no reviews for IFI44 Antibody (NBP2-55064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IFI44 Antibody (NBP2-55064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional IFI44 Products

Bioinformatics Tool for IFI44 Antibody (NBP2-55064)

Discover related pathways, diseases and genes to IFI44 Antibody (NBP2-55064). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI44 Antibody (NBP2-55064)

Discover more about diseases related to IFI44 Antibody (NBP2-55064).

Pathways for IFI44 Antibody (NBP2-55064)

View related products by pathway.

PTMs for IFI44 Antibody (NBP2-55064)

Learn more about PTMs related to IFI44 Antibody (NBP2-55064).

Blogs on IFI44

There are no specific blogs for IFI44, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IFI44 Antibody and receive a gift card or discount.


Gene Symbol IFI44