CTR9 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CTR9 Antibody [NBP2-57251] - Staining of human cell line HEK 293 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CTR9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CTR9 Antibody - BSA Free (NBP2-57251) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQT
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTR9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CTR9 Recombinant Protein Antigen (NBP2-57251PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CTR9 Antibody - BSA Free

• Ctr9, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
• KIAA0155SH2 domain-binding protein 1
• p150TSP
• RNA polymerase-associated protein CTR9 homolog
• SH2 domain binding protein 1 (tetratricopeptide repeat containing)
• SH2BP1p150
• TPR-containing, SH2-binding phosphoprotein
• TSBP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTR9