ARFGEF1 Antibody

Images

 
Western Blot: ARFGEF1 Antibody [NBP1-88840] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: ARFGEF1 Antibody [NBP1-88840] - Staining of mouse piriform cortex shows neuronal staining in various layers.
Immunohistochemistry-Paraffin: ARFGEF1 Antibody [NBP1-88840] - Staining of human cerebral cortex shows strong positivity in subsets of neurons.
Immunocytochemistry/ Immunofluorescence: ARFGEF1 Antibody [NBP1-88840] - Staining of mouse gigantocellular reticular nucleus shows immunoreactivity in neuronal cell bodies and processes.
Immunocytochemistry/ Immunofluorescence: ARFGEF1 Antibody [NBP1-88840] - Staining of mouse hippocampus shows positivity in the CA3 area neurons.
Immunocytochemistry/ Immunofluorescence: ARFGEF1 Antibody [NBP1-88840] - Staining of mouse olfactory bulb shows positivity in neurons and processes in the mitral and external plexiform layers.
Immunocytochemistry/ Immunofluorescence: ARFGEF1 Antibody [NBP1-88840] - Staining of mouse parietal association cortex shows positivity in neuronal cell bodies and dendrites.
Immunocytochemistry/ Immunofluorescence: ARFGEF1 Antibody [NBP1-88840] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: ARFGEF1 Antibody [NBP1-88840] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: ARFGEF1 Antibody [NBP1-88840] - Staining of human cerebral cortex shows cytoplasmic immunoreactivity in neuronal cell bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARFGEF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARFGEF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARFGEF1 Protein (NBP1-88840PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARFGEF1 Antibody

  • ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldinA-inhibited)
  • ARFGEP1P200
  • BIG1p200
  • Brefeldin A-inhibited GEP 1
  • brefeldin A-inhibited guanine nucleotide-exchange protein 1
  • D730028O18Rik
  • DKFZP434L057
  • p200 ARF guanine nucleotide exchange factor
  • p200 ARF-GEP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-88607
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027044-R01
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ARFGEF1 Antibody (NBP1-88840) (0)

There are no publications for ARFGEF1 Antibody (NBP1-88840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARFGEF1 Antibody (NBP1-88840) (0)

There are no reviews for ARFGEF1 Antibody (NBP1-88840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARFGEF1 Antibody (NBP1-88840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARFGEF1 Products

Bioinformatics Tool for ARFGEF1 Antibody (NBP1-88840)

Discover related pathways, diseases and genes to ARFGEF1 Antibody (NBP1-88840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFGEF1 Antibody (NBP1-88840)

Discover more about diseases related to ARFGEF1 Antibody (NBP1-88840).
 

Pathways for ARFGEF1 Antibody (NBP1-88840)

View related products by pathway.

PTMs for ARFGEF1 Antibody (NBP1-88840)

Learn more about PTMs related to ARFGEF1 Antibody (NBP1-88840).

Blogs on ARFGEF1

There are no specific blogs for ARFGEF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARFGEF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARFGEF1