![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody NBP1-88829 (A) shows similar protein distribution across tissues to independent antibody NBP1-88854 (B).](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0012.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody NBP1-88829 (A) shows similar protein distribution across tissues to independent antibody NBP1-88854 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTEVPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKLLQNRI |
| Specificity | Specificity of human ASCC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ASCC3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. ASCC3 antibody is validated for WB from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Margherita verardo |
WB | Human | 07/13/2020 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for ASCC3 Antibody (NBP1-88829)Discover more about diseases related to ASCC3 Antibody (NBP1-88829).
| Pathways for ASCC3 Antibody (NBP1-88829)View related products by pathway.
|
PTMs for ASCC3 Antibody (NBP1-88829)Learn more about PTMs related to ASCC3 Antibody (NBP1-88829).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ASCC3 |
![Western Blot: ASCC3 Antibody [NBP1-88829] - Western blot analysis of human skeletal muscle cell lysate (right lane). MWM in right lane (kDa). Western blot image submitted by a verified customer review.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Western-Blot-NBP1-88829-img0015.jpg "Western Blot: ASCC3 Antibody [NBP1-88829] - Western blot analysis of human skeletal muscle cell lysate (right lane). MWM in right lane (kDa). Western blot image submitted by a verified customer review.")
![Immunocytochemistry/Immunofluorescence: ASCC3 Antibody [NBP1-88829] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88829-img0006.jpg "Immunocytochemistry/Immunofluorescence: ASCC3 Antibody [NBP1-88829] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human colon.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0014.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human colon.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0007.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0008.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0009.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0010.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0011.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize2/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0013.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex.")
![Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.](http://images.novusbio.com/images2/KAT3B-p300-Antibody-(RW105)-Immunocytochemistry-Immunofluorescence-NB100-616-img0005.jpg)
![Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.](http://images.novusbio.com/images2/KAT3B-p300-Antibody-(RW105)-Western-Blot-NB100-616-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B/p300 Antibody (RW105) NB100-616 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.](http://images.novusbio.com/images2/KAT3B-p300-Antibody-(RW105)-Immunocytochemistry-Immunofluorescence-NB100-616-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: EBPL Antibody [NBP2-13943] - Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.](http://images.novusbio.com/images2/EBPL Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13943-img0003.jpg)
![Immunohistochemistry-Paraffin: EBPL Antibody [NBP2-13943] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/images2/EBPL-Antibody-Immunohistochemistry-Paraffin-NBP2-13943-img0001.jpg)
![Western Blot: ELK3 Antibody (OTI1H3) [NBP2-01264] - Breast cancer cells. Lane 1: MDA-MB231 + Negative control siRNA. Lane 2: MDA-MB231 + siELK3-1. Lane 3: MDA-MB231 + siELK3-2. Image from verified customer review.](http://images.novusbio.com/images2/ELK3-Antibody-(OTI1H3)-Western-Blot-NBP2-01264-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: ELK3 Antibody (1H3) [NBP2-01264] Staining of COS7 cells transiently transfected by pCMV6-ENTRY ELK3.](http://images.novusbio.com/images/ELK3 Antibody (1H3)-Immunocytochemistry-Immunofluorescence-NBP2-01264-img0008.jpg)
![Immunohistochemistry-Paraffin: ELK3 Antibody (1H3) [NBP2-01264] - Staining of paraffin-embedded Human tonsil using anti-ELK3 mouse monoclonal antibody.](http://images.novusbio.com/images/ELK3 Antibody (1H3)-Immunohistochemistry-Paraffin-NBP2-01264-img0007.jpg)
![Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.](http://images.novusbio.com/images2/CDP-CUTL1-Antibody-Western-Blot-NBP2-13883-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm and the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/images2/CDP-CUTL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13883-img0006.jpg)
![Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/images2/CDP-CUTL1-Antibody-Immunohistochemistry-Paraffin-NBP2-13883-img0011.jpg)
![Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.](http://images.novusbio.com/images2/NFkB-p105-p50-Antibody-(2J10D7)-Western-Blot-NB100-56583-img0004.jpg)
![Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review](http://images.novusbio.com/images2/NFkB-p105-p50-Antibody-(2J10D7)-Immunohistochemistry-Paraffin-NB100-56583-img0009.jpg)
![Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.](http://images.novusbio.com/images2/NFkB-p105-p50-Antibody-(2J10D7)-Flow-Cytometry-NB100-56583-img0008.jpg)
![Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/images2/ARHGEF7-Antibody-Western-Blot-NBP1-88650-img0012.jpg)
![Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/images2/ARHGEF7-Antibody-Immunohistochemistry-Paraffin-NBP1-88650-img0011.jpg)
![Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/images2/ARHGEF7-Antibody-Western-Blot-NBP1-88650-img0007.jpg)
![Western Blot: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ASCC1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ASCC1.](http://images.novusbio.com/images/ASCC1 Antibody (6G5)-Western Blot-NBP2-01345-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] Staining of COS7 cells transiently transfected by pCMV6-ENTRY ASCC1.](http://images.novusbio.com/images/ASCC1 Antibody (6G5)-Immunocytochemistry-Immunofluorescence-NBP2-01345-img0006.jpg)
![Immunohistochemistry-Paraffin: ASCC1 Antibody (OTI6G5) [NBP2-01345] - ASCC1 Antibody (6G5) [NBP2-01345] - Staining of paraffin-embedded Human tonsil using anti-ASCC1 mouse monoclonal antibody.](http://images.novusbio.com/images/ASCC1 Antibody (6G5)-Immunohistochemistry-Paraffin-NBP2-01345-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - CD40-transfected L cells stained.](http://images.novusbio.com/images2/CD40-TNFRSF5-Antibody-(mAb89)-Immunocytochemistry-Immunofluorescence-DDX0131P-100-img0003.jpg)
![Immunohistochemistry: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - IHC staining on Bouin paraffinlymph node section. HumanCD40 stained with mAb 89.](http://images.novusbio.com/images2/CD40-TNFRSF5-Antibody-(mAb89)-Immunohistochemistry-DDX0131P-100-img0004.jpg)
![Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Western-Blot-NBP1-69571-img0006.jpg)
![Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Immunohistochemistry-NBP1-69571-img0007.jpg)
![Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Western-Blot-NBP1-69571-img0003.jpg)
![Western Blot: SART3 Antibody [NB100-74648] - Detection of Human SART3/TIP110 on HeLa whole cell lysate using NB100-74648. SART3 was also immunoprecipitated by rabbit anti-SART3 antibody NB100-74649.](http://images.novusbio.com/images2/SART3-Antibody-Western-Blot-NB100-74648-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: SART3 Antibody [NB100-74648] - FFPE section of human pancreatic islet cell tumor. Affinity purified rabbit anti-SART3 used at a dilution of 1:100. Detection: Red fluorescent goat anti-rabbit IgG highly cross-adsorbed Antibody Hilyte PlusTM 555 used at a dilution of 1:100.](http://images.novusbio.com/images2/SART3-Antibody-Immunocytochemistry-Immunofluorescence-NB100-74648-img0003.jpg)
![Immunohistochemistry: SART3 Antibody [NB100-74648] - Sample: FFPE sections of human ovarian carcinoma (left) and colon carcinoma (right). Antibody: Affinity purified rabbit anti- SART3/TIP110 used at a dilution of 1:200 (1ug/ml) and 1:400 (0.5 ug/ml). Detection: DAB and Red-fluorescent Goat anti-Rabbit IgG](http://images.novusbio.com/images2/SART3-Antibody-Immunohistochemistry-NB100-74648-img0005.jpg)
![Western Blot: OAS3 Antibody [NBP1-85841] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/images2/OAS3-Antibody-Western-Blot-NBP1-85841-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: OAS3 Antibody [NBP1-85841] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/OAS3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85841-img0006.jpg)
![Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/images2/OAS3-Antibody-Immunohistochemistry-Paraffin-NBP1-85841-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: TPX2 Antibody [NB500-179] - Analysis of TPX2 at the mitotic spindle microtubules and poles in a HeLa metaphase cell. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/TPX2-Antibody-Immunocytochemistry-Immunofluorescence-NB500-179-img0004.jpg)
![Flow Cytometry: TPX2 Antibody [NB500-179] - RHAMM is not a cell surface but an intracellular cytoskeletal protein in mouse embryonic stem (ES) cells. (C) Alcohol permeabilized mouse ES cells, however, were strongly positive for both RHAMM and the intracellular positive control protein TPX2 (right panel). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0073548) licensed under a CC-BY licence.](http://images.novusbio.com/images2/TPX2-Antibody-Flow-Cytometry-NB500-179-img0005.jpg)
![Western Blot: TPX2 Antibody [NB500-179] - Analysis of TPX2 expression in 1) HeLa, 2) Ntera2, 3) K-562 and 4) Raji whole cell lysates using NB500-179.](http://images.novusbio.com/images2/TPX2 Antibody-Western Blot-NB500-179-img0001.jpg)
![Western Blot: ASCC2 Antibody (OTI1E8) - Azide and BSA Free [NBP2-72273] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ASCC2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ASCC2.](http://images.novusbio.com/images2/ASCC2-Antibody-(OTI1E8)---Azide-and-BSA-Free-Western-Blot-NBP2-72273-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: ASCC2 Antibody (OTI1E8) - Azide and BSA Free [NBP2-72273] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY ASCC2.](http://images.novusbio.com/images2/ASCC2-Antibody-(OTI1E8)---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-72273-img0003.jpg)
![Flow Cytometry: ASCC2 Antibody (OTI1E8) - Azide and BSA Free [NBP2-72273] - Analysis of Hela cells, using anti-ASCC2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images2/ASCC2-Antibody-(OTI1E8)---Azide-and-BSA-Free-Flow-Cytometry-NBP2-72273-img0002.jpg)
![Western Blot: SND1 Antibody [NBP2-94469] - Analysis of extracts of various cell lines, using SND1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/images2/SND1 Antibody-Western Blot-NBP2-94469-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: SND1 Antibody [NBP2-94469] - Analysis of NIH/3T3 cells using SND1 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/SND1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94469-img0002.jpg)
![Immunohistochemistry-Paraffin: SND1 Antibody [NBP2-94469] - Paraffin-embedded human kidney cancer using SND1.](http://images.novusbio.com/images2/SND1-Antibody-Immunohistochemistry-Paraffin-NBP2-94469-img0003.jpg)
![Western Blot: IKBKAP Antibody (6G9) [H00008518-M03] - Analysis of IKBKAP expression in HeLa (Cat # L013V1).](http://images.novusbio.com/images2/IKBKAP Antibody (6G9)-Western Blot-H00008518-M03-img0005.jpg)
![Immunohistochemistry-Paraffin: IKBKAP Antibody (6G9) [H00008518-M03] - Analysis of monoclonal antibody to IKBKAP on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml](http://images.novusbio.com/images2/IKBKAP-Antibody-(6G9)-Immunohistochemistry-Paraffin-H00008518-M03-img0004.jpg)
![ELISA: IKBKAP Antibody (6G9) [H00008518-M03] - Detection limit for recombinant GST tagged IKBKAP is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/images2/IKBKAP-Antibody-(6G9)-ELISA-H00008518-M03-img0003.jpg)
![Western Blot: CHAF1A Antibody (SS 1 1-13) [NB500-207] - Analysis of CAF1 p150 expression in Ntera2 whole cell lysate using NB500-207.](http://images.novusbio.com/images2/CHAF1A Antibody (SS 1 1-13)-Western Blot-NB500-207-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: CHAF1A Antibody (SS 1 1-13) [NB500-207] - Immunofluorescent staining of CAF-1-p150 in HeLa cells (Shibahara et al 1999).](http://images.novusbio.com/images2/CHAF1A Antibody (SS 1 1-13)-Immunocytochemistry-Immunofluorescence-NB500-207-img0004.jpg)
![Western Blot: CTR9 Antibody [NB100-68205] - Detection of Human and Mouse CTR9 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CTR9 antibody NB100-68205 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/CTR9-Antibody-Western-Blot-NB100-68205-img0012.jpg)
![Immunohistochemistry: CTR9 Antibody [NB100-68205] - Sample: FFPE section of mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-CTR9 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).](http://images.novusbio.com/images2/CTR9-Antibody-Immunohistochemistry-NB100-68205-img0010.jpg)
![Western Blot: CTR9 Antibody [NB100-68205] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg) and mouse NIH3T3 (M; 50 mcg) cells. NB100-68205 used for WB at 0.04 mcg/ml (A) and 0.1 mcg/ml (B) and used for IP at 3 mcg/mg lysate.](http://images.novusbio.com/images2/CTR9-Antibody-Western-Blot-NB100-68205-img0002.jpg)
![Western Blot: PIK3R4 Antibody [NBP1-30463] - Whole cell lysate from HeLa, 293T and mouse NIH3T3 cells. Vps15 was also immunoprecipitated by rabbit anti-Vps15 antibody NBP1-30462.](http://images.novusbio.com/images2/PIK3R4-Antibody-Western-Blot-NBP1-30463-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")