Home » ASCC3 » ASCC3 Antibodies » ASCC3 Antibody

ASCC3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ASCC3 Antibody [NBP1-88829] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunocytochemistry/ Immunofluorescence: ASCC3 Antibody [NBP1-88829] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ASCC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTEVPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKLLQNRI
Specificity
Specificity of human ASCC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASCC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASCC3 Protein (NBP1-88829PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASCC3 Antibody

  • activating signal cointegrator 1 complex subunit 3
  • B630009I04Rik
  • HELIC1
  • helicase, ATP binding 1
  • p200
  • RNA helicase family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

KAT3B/p300
Antibody (RW105)
NB100-616
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-KAT3B/p300 (RW105) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow (Intracellular): KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on RAW 246.7 cells with KAT3B/p300 antibody (RW105) NB100-616PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(8 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
EBPL Antibody
NBP2-13943
Immunocytochemistry/Immunofluorescence: EBPL Antibody [NBP2-13943] - Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: EBPL Antibody [NBP2-13943] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ELK3 Antibody
(OTI1H3)
NBP2-01264
Western Blot: ELK3 Antibody (1H3) [NBP2-01264] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ELK3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ELK3.
Immunocytochemistry/Immunofluorescence: ELK3 Antibody (1H3) [NBP2-01264] Staining of COS7 cells transiently transfected by pCMV6-ENTRY ELK3.
Immunohistochemistry-Paraffin: ELK3 Antibody (1H3) [NBP2-01264] - Staining of paraffin-embedded Human tonsil using anti-ELK3 mouse monoclonal antibody.
(1 Publication)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 expression in transfected 293T cell line by CUTL1 monoclonal antibody (M01), clone 2A10.Lane 1: CUX1 transfected lysate(77.2 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration 5 ug/ml.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NFkB p50 (NLS)
Inhibitor Peptide Set
NBP2-29323
Functional (Inhibition): NFkB p105/p50 Inhibitor Peptide Set [NBP2-29323] - TLR5/NF-kB/SEAPorter HEK 293 (NBP2-26277) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated with different concentrations (0, 1, 5, 10, 25 and 50 uM) of Inhibitory Peptide (NBP2-29323) and Control Peptide (NBP2-29334) for 1 h. Cells were then stimulated with 1 ng/ml Flagellin (NBP2-25289) for 24 h. Secreted alkaline phosphatase (SEAP) was analyzed using SEAPorter Assay Kit (NBP2-25285). *p < 0.05 versus control peptide at the corresponding concentrations (Mann-Whitney U test).
(10 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Western Blot: ASCC1 Antibody (6G5) [NBP2-01345] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ASCC1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ASCC1.
Immunocytochemistry/Immunofluorescence: ASCC1 Antibody (6G5) [NBP2-01345] Staining of COS7 cells transiently transfected by pCMV6-ENTRY ASCC1.
Immunohistochemistry-Paraffin: ASCC1 Antibody (6G5) [NBP2-01345] - Staining of paraffin-embedded Human tonsil using anti-ASCC1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CD40/TNFRSF5
Antibody (mAb89)
DDX0131P-100
Immunocytochemistry/Immunofluorescence: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - CD40-transfected L cells stained.
Immunohistochemistry: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - IHC staining on Bouin paraffinlymph node section. HumanCD40 stained with mAb 89.
(11 Publications)
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunocytochemistry/Immunofluorescence: PMEL17/SILV Antibody (10E5) [NBP1-47974] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded prostate tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
SART3 Antibody
NB100-74648
Western Blot: SART3 Antibody [NB100-74648] - Detection of Human SART3/TIP110 on HeLa whole cell lysate using NB100-74648. SART3 was also immunoprecipitated by rabbit anti-SART3 antibody NB100-74649.
Immunocytochemistry/Immunofluorescence: SART3 Antibody [NB100-74648] - FFPE section of human pancreatic islet cell tumor. Affinity purified rabbit anti-SART3 used at a dilution of 1:100. Detection: Red fluorescent goat anti-rabbit IgG highly cross-adsorbed Antibody Hilyte PlusTM 555 used at a dilution of 1:100.
Immunohistochemistry: SART3 Antibody [NB100-74648] - Sample: FFPE sections of human ovarian carcinoma (left) and colon carcinoma (right). Antibody: Affinity purified rabbit anti- SART3/TIP110 used at a dilution of 1:200 (1ug/ml) and 1:400 (0.5 ug/ml). Detection: DAB and Red-fluorescent Goat anti-Rabbit IgG
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
OAS3 Antibody
NBP1-85841
Western Blot: OAS3 Antibody [NBP1-85841] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: OAS3 Antibody [NBP1-85841] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TPX2 Antibody
NB500-179
Western Blot: TPX2 Antibody [NB500-179] - Analysis of TPX2 expression in 1) HeLa, 2) Ntera2, 3) K-562 and 4) Raji whole cell lysates using NB500-179.
Immunocytochemistry/Immunofluorescence: TPX2 Antibody [NB500-179] - analysis of TPX2 at the mitotic spindle microtubules and poles in a HeLa metaphase cell. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: TPX2 Antibody [NB500-179] - Staining of HeLa cells fixed in 3.5% paraformaldehyde using NB 500-179 (1:1,000). Nuclear staining during interphase and spindle staining during mitosis.
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
ASCC2 Antibody
NBP1-88815
Western Blot: ASCC2 Antibody [NBP1-88815] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: ASCC2 Antibody [NBP1-88815] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, cytosol & focal adhesion sites.
Immunohistochemistry-Paraffin: ASCC2 Antibody [NBP1-88815] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
SND1 Protein
H00027044-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western
Aminopeptidase
N/CD13 Antibody
NBP2-33855
Western Blot: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Analysis in human small intestine tissue.
Immunocytochemistry/Immunofluorescence: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining of human cell line BJ shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody [NBP2-33855] - Staining in human small intestine and cerebral cortex tissues using anti-ANPEP antibody. Corresponding ANPEP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
IKBKAP Antibody
NBP1-76788
Western Blot: IKBKAP Antibody [NBP1-76788] - A-20 cell lysate with IKBKAP antibody at in (A) 0.5, and (B) 1 u/mL.
Immunocytochemistry: IKBKAP Antibody [NBP1-76788] - A-20 cells with IKBKAP antibody at 1 ug/ml.
Immunofluorescence: IKBKAP Antibody [NBP1-76788] - Immunofluorescence of IKAP in A20 cells with IKAP antibody at 20 ug/mL.
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
CHAF1A Antibody
(SS 1 1-13)
NB500-207
Western Blot: CHAF1A Antibody (SS 1 1-13) [NB500-207] - Analysis of CAF1 p150 expression in Ntera2 whole cell lysate using NB500-207.
Immunocytochemistry/Immunofluorescence: CHAF1A Antibody (SS 1 1-13) [NB500-207] - Immunofluorescent staining of CAF-1-p150 in HeLa cells (Shibahara et al 1999).
(8 Publications)
Species: Hu
Applications: WB, ICC/IF, IP
CTR9 Antibody
NB100-68205
Western Blot: CTR9 Antibody [NB100-68205] - Detection of Human and Mouse CTR9 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CTR9 antibody NB100-68205 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry: CTR9 Antibody [NB100-68205] - Sample: FFPE section of mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-CTR9 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).
Western Blot: CTR9 Antibody [NB100-68205] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg) and mouse NIH3T3 (M; 50 mcg) cells. NB100-68205 used for WB at 0.04 mcg/ml (A) and 0.1 mcg/ml (B) and used for IP at 3 mcg/mg lysate.
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
PIK3R4 Antibody
NBP1-30463
Western Blot: PIK3R4 Antibody [NBP1-30463] - Whole cell lysate from HeLa, 293T and mouse NIH3T3 cells. Vps15 was also immunoprecipitated by rabbit anti-Vps15 antibody NBP1-30462.
(4 Publications)
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP

Publications for ASCC3 Antibody (NBP1-88829) (0)

There are no publications for ASCC3 Antibody (NBP1-88829).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCC3 Antibody (NBP1-88829) (0)

There are no reviews for ASCC3 Antibody (NBP1-88829). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ASCC3 Antibody (NBP1-88829) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASCC3 Products

Bioinformatics Tool for ASCC3 Antibody (NBP1-88829)

Discover related pathways, diseases and genes to ASCC3 Antibody (NBP1-88829). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCC3 Antibody (NBP1-88829)

Discover more about diseases related to ASCC3 Antibody (NBP1-88829).
 

Pathways for ASCC3 Antibody (NBP1-88829)

View related products by pathway.

PTMs for ASCC3 Antibody (NBP1-88829)

Learn more about PTMs related to ASCC3 Antibody (NBP1-88829).

Blogs on ASCC3

There are no specific blogs for ASCC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASCC3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ASCC3