Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTEVPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKLLQNRI |
Specificity | Specificity of human ASCC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ASCC3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. ASCC3 antibody is validated for WB from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2), 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Margherita verardo |
WB | Human | 07/13/2020 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for ASCC3 Antibody (NBP1-88829)Discover more about diseases related to ASCC3 Antibody (NBP1-88829).
| Pathways for ASCC3 Antibody (NBP1-88829)View related products by pathway.
|
PTMs for ASCC3 Antibody (NBP1-88829)Learn more about PTMs related to ASCC3 Antibody (NBP1-88829).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ASCC3 |