ASCC3 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody NBP1-88829 (A) shows similar protein ...read more
Western Blot: ASCC3 Antibody [NBP1-88829] - Western blot analysis of human skeletal muscle cell lysate (right lane). MWM in right lane (kDa). Western blot image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: ASCC3 Antibody [NBP1-88829] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human colon.
Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

ASCC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTEVPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKLLQNRI
Specificity
Specificity of human ASCC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASCC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. ASCC3 antibody is validated for WB from a verified customer review.
Control Peptide
ASCC3 Protein (NBP1-88829PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-88829 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASCC3 Antibody

  • activating signal cointegrator 1 complex subunit 3
  • B630009I04Rik
  • HELIC1
  • helicase, ATP binding 1
  • p200
  • RNA helicase family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-01345
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP, KD
NBP2-72273
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, CyTOF-ready
NBP2-94469
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
H00008518-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB100-68205
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IP

Publications for ASCC3 Antibody (NBP1-88829) (0)

There are no publications for ASCC3 Antibody (NBP1-88829).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ASCC3 Antibody (NBP1-88829) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-88829:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ASCC3 NBP1-88829
Enlarge
5
reviewed by:
Margherita verardo
WB Human 07/13/2020
View

Summary

ApplicationWestern Blot
Sample TestedSkeletal muscle
SpeciesHuman
LotA116717

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASCC3 Antibody (NBP1-88829) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ASCC3 Products

Array NBP1-88829

Bioinformatics Tool for ASCC3 Antibody (NBP1-88829)

Discover related pathways, diseases and genes to ASCC3 Antibody (NBP1-88829). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCC3 Antibody (NBP1-88829)

Discover more about diseases related to ASCC3 Antibody (NBP1-88829).
 

Pathways for ASCC3 Antibody (NBP1-88829)

View related products by pathway.

PTMs for ASCC3 Antibody (NBP1-88829)

Learn more about PTMs related to ASCC3 Antibody (NBP1-88829).

Blogs on ASCC3

There are no specific blogs for ASCC3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Margherita verardo
07/13/2020
Application: WB
Species: Human

Bioinformatics

Gene Symbol ASCC3