CTGF/CCN2 Antibody (CL5339)

Images

 
Western Blot: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Analysis in human cell line U-251 MG.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of rat cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of human cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of mouse cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of mouse cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of rat cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL5339
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CTGF/CCN2 Antibody (CL5339) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
CCN2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CTGF/CCN2 Antibody (CL5339)

  • CCN2
  • CCN2IGFBP-8
  • connective tissue growth factor
  • CTGF
  • CTGRP
  • Fisp12
  • HCS24
  • Hypertrophic chondrocyte-specific protein 24
  • IBP-8
  • IGF-binding protein 8
  • IGFBP-8
  • IGFBP8CCN family member 2
  • Insulin-like growth factor-binding protein 8
  • MGC102839
  • NOV2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1640
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
7754-BH/CF
Species: Hu
Applications: BA
AF4055
Species: Mu
Applications: IHC, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
DTM100
Species: Hu
Applications: ELISA
DTSP10
Species: Hu
Applications: ELISA

Publications for CTGF/CCN2 Antibody (NBP2-61415) (0)

There are no publications for CTGF/CCN2 Antibody (NBP2-61415).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTGF/CCN2 Antibody (NBP2-61415) (0)

There are no reviews for CTGF/CCN2 Antibody (NBP2-61415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTGF/CCN2 Antibody (NBP2-61415). (Showing 1 - 1 of 1 FAQ).

  1. We are looking for a pair of mouse CTGF antibody for ELISA, we prefer no azide and/or glycerol, and in carrier free form (no EDTA, no Tris, no BSA). For the validation, we need approximately 100ug. If it works, we'll order more later.
    • Unfortunately we do not carry any CTGF antibodies that suit your specifications. We do carry AbSelect antibody purification kits that will remove BSA, Tris and azide from antibody formulations which may be an option for you.

Secondary Antibodies

 

Isotype Controls

Additional CTGF/CCN2 Products

Bioinformatics Tool for CTGF/CCN2 Antibody (NBP2-61415)

Discover related pathways, diseases and genes to CTGF/CCN2 Antibody (NBP2-61415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTGF/CCN2 Antibody (NBP2-61415)

Discover more about diseases related to CTGF/CCN2 Antibody (NBP2-61415).
 

Pathways for CTGF/CCN2 Antibody (NBP2-61415)

View related products by pathway.

PTMs for CTGF/CCN2 Antibody (NBP2-61415)

Learn more about PTMs related to CTGF/CCN2 Antibody (NBP2-61415).
 

Research Areas for CTGF/CCN2 Antibody (NBP2-61415)

Find related products by research area.

Blogs on CTGF/CCN2

There are no specific blogs for CTGF/CCN2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTGF/CCN2 Antibody (CL5339) and receive a gift card or discount.

Bioinformatics

Gene Symbol CCN2