Home » CTGF/CCN2 » CTGF/CCN2 Antibodies » CTGF/CCN2 Antibody (CL5339)

CTGF/CCN2 Antibody (CL5339)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Analysis in human cell line U-251 MG.
Western Blot: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Analysis in human cell line U-251 MG.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of rat cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of human cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of mouse cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of mouse cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody (CL5339) [NBP2-61415] - Staining of rat cerebral cortex shows strong cytoplasmic positivity in layer 6b neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL5339
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CTGF/CCN2 Antibody (CL5339) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
CCN2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CTGF/CCN2 Antibody (CL5339)

  • CCN2
  • CCN2IGFBP-8
  • connective tissue growth factor
  • CTGF
  • CTGRP
  • Fisp12
  • HCS24
  • Hypertrophic chondrocyte-specific protein 24
  • IBP-8
  • IGF-binding protein 8
  • IGFBP-8
  • IGFBP8CCN family member 2
  • Insulin-like growth factor-binding protein 8
  • MGC102839
  • NOV2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOV/CCN3 Antibody
AF1640
NOV/CCN3 was detected in immersion fixed paraffin-embedded sections of human renal cancer tissue using Goat Anti-Human NOV/CCN3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1640) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(38 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
TGF-beta 1
[Unconjugated]
7754-BH/CF
Recombinant human TGF-beta 1 (7754-BH/CF) inhibits recombinant mouse IL-4 induced proliferation in the HT-2 mouse T cell line. The ED50 for this effect is 0.04-0.2 ng/mL.
(15 Publications)
Species: Hu
Applications: BA
Cyr61/CCN1
Antibody [Unconjugate
AF4055
Western blot shows lysates of mouse spleenocyte cell, RAW 264.7 mouse monocyte/macrophage cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and A20 mouse B cell lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Mouse Cyr61/CCN1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4055) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Cyr61/CCN1 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Cyr61/CCN1 was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using 15 µg/mL Mouse Cyr61/CCN1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4055) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of muscle cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyr61/CCN1 at approximately 51 kDa (as indicated) using 10 µg/mL of Sheep Anti-Mouse Cyr61/CCN1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4055) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(5 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
VEGF [HRP]
DVE00
(26 Reviews)
(600 Publications)
Species: Hu
Applications: ELISA
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Plexin A1 Antibody
[Unconjugated]
AF4309
Plexin A1 was detected in immersion fixed frozen sections of embryonic mouse spinal cord using Mouse Plexin A1 Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Plexin A1 was detected in immersion fixed immature human dendritic cells using Goat Anti-Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Western blot shows lysates of mouse embryonic heart tissue. PVDF Membrane was probed with 1 µg/mL of Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Plexin A1 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(5 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
RPL10 Antibody
NBP1-84037
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(719 Publications)
Species: Hu
Applications: BA
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody - BSA Free [NBP1-30027] - Analysis of a FFPE tissue section of human placenta using 1:200 dilution of Serpin A8 (NBP1-30027) antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Smad2/3 Antibody
[Unconjugated]
AF3797
Western blot shows lysates of A549 human lung carcinoma cell line, Jurkat human acute T cell leukemia cell line, HEK293 human embryonic kidney cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human/Mouse Smad2/3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3797) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human Smad2 and Smad3 were included. Specific bands for Smad2 were detected at approximately 64 and 58 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Smad2/3/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse Smad2/3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3797) or control antibody (Catalog # AB‑108‑C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The c-myc promoter was detected by standard PCR.
Smad2/3 was detected in immersion fixed MCF‑7 human breast cancer cell line induced (upper panel) or non-induced (lower panel) to undergo epithelial-mesenchymal transition (EMT) using Goat Anti-Human/Mouse Smad2/3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3797) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and, in EMT-induced cells, nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(14 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Smad3 Antibody
NB100-56479
Immunocytochemistry/Immunofluorescence: Smad3 Antibody [NB100-56479] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Smad3 at 10 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: Smad3 Antibody [NB100-56479] - Analysis in human fibroblast and HeLa whole cell lysates. Untreated lysates show a band around 55 kDa. 1:1000 dilution, 1 hour blocking in milk 5%. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Smad3 Antibody [NB100-56479] - Human liver tissue probed with SMAD3 antibody (bottom left, right) and isotype control antibody (top left) at 10 ug/mL.
(5 Reviews)
(5 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
D6050
(32 Reviews)
(644 Publications)
Species: Hu
Applications: ELISA
CCL2/JE/MCP-1 [HRP]
DCP00
(8 Reviews)
(226 Publications)
Species: Hu
Applications: ELISA
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(39 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
TIMP-1 [HRP]
DTM100
(3 Reviews)
(93 Publications)
Species: Hu
Applications: ELISA
Thrombospondin-1
[HRP]
DTSP10
(1 Review)
(36 Publications)
Species: Hu
Applications: ELISA

Publications for CTGF/CCN2 Antibody (NBP2-61415) (0)

There are no publications for CTGF/CCN2 Antibody (NBP2-61415).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTGF/CCN2 Antibody (NBP2-61415) (0)

There are no reviews for CTGF/CCN2 Antibody (NBP2-61415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTGF/CCN2 Antibody (NBP2-61415). (Showing 1 - 1 of 1 FAQ).

  1. We are looking for a pair of mouse CTGF antibody for ELISA, we prefer no azide and/or glycerol, and in carrier free form (no EDTA, no Tris, no BSA). For the validation, we need approximately 100ug. If it works, we'll order more later.
    • Unfortunately we do not carry any CTGF antibodies that suit your specifications. We do carry AbSelect antibody purification kits that will remove BSA, Tris and azide from antibody formulations which may be an option for you.

Secondary Antibodies

 

Isotype Controls

Additional CTGF/CCN2 Products

Bioinformatics Tool for CTGF/CCN2 Antibody (NBP2-61415)

Discover related pathways, diseases and genes to CTGF/CCN2 Antibody (NBP2-61415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTGF/CCN2 Antibody (NBP2-61415)

Discover more about diseases related to CTGF/CCN2 Antibody (NBP2-61415).
 

Pathways for CTGF/CCN2 Antibody (NBP2-61415)

View related products by pathway.

PTMs for CTGF/CCN2 Antibody (NBP2-61415)

Learn more about PTMs related to CTGF/CCN2 Antibody (NBP2-61415).
 

Research Areas for CTGF/CCN2 Antibody (NBP2-61415)

Find related products by research area.

Blogs on CTGF/CCN2

There are no specific blogs for CTGF/CCN2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTGF/CCN2 Antibody (CL5339) and receive a gift card or discount.


Bioinformatics

Gene Symbol CCN2