CSDE1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CSDE1 Antibody [NBP2-38665] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP2-38665] - Staining in human testis and pancreas tissues using anti-CSDE1 antibody. Corresponding CSDE1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: CSDE1 Antibody [NBP2-38665] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP2-38665] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP2-38665] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSDE1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVD
Specificity
Specificity of human CSDE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSDE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CSDE1 Protein (NBP2-38665PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSDE1 Antibody

  • cold shock domain containing E1, RNA-binding
  • cold shock domain-containing protein E1
  • D1S155EUNRRP5-1000E10.3
  • DKFZp779B0247
  • DKFZp779J1455
  • FLJ26882
  • KIAA0885
  • N-ras upstream gene protein
  • NRAS-related
  • NRU
  • Protein UNR
  • upstream of NRAS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20521
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-35212
Species: Hu
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-75527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-496
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-76636
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NBP1-88518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38665
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CSDE1 Antibody (NBP2-38665) (0)

There are no publications for CSDE1 Antibody (NBP2-38665).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSDE1 Antibody (NBP2-38665) (0)

There are no reviews for CSDE1 Antibody (NBP2-38665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CSDE1 Antibody (NBP2-38665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CSDE1 Antibody (NBP2-38665)

Discover related pathways, diseases and genes to CSDE1 Antibody (NBP2-38665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSDE1 Antibody (NBP2-38665)

Discover more about diseases related to CSDE1 Antibody (NBP2-38665).
 

Pathways for CSDE1 Antibody (NBP2-38665)

View related products by pathway.

PTMs for CSDE1 Antibody (NBP2-38665)

Learn more about PTMs related to CSDE1 Antibody (NBP2-38665).

Blogs on CSDE1

There are no specific blogs for CSDE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSDE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSDE1
Uniprot