MSL2L1 Antibody

Images

 
Western Blot: MSL2L1 Antibody [NBP1-83853] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: MSL2L1 Antibody [NBP1-83853] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: MSL2L1 Antibody [NBP1-83853] - Staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells and islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MSL2L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MSL2L1 Protein (NBP1-83853PEP)
Publications
Read Publication using
NBP1-83853 in the following applications:

  • 1 publication
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24842875).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MSL2L1 Antibody

  • FLJ10546
  • KIAA1585FLJ54913
  • male-specific lethal 2 homolog (Drosophila)
  • male-specific lethal 2 homolog
  • male-specific lethal 2-like 1 (Drosophila)
  • Male-specific lethal 2-like 1
  • Male-specific lethal-2 homolog 1
  • MSL-2
  • MSL2L1
  • MSL2-like 1
  • PHNPCC4
  • PMS2
  • RING finger protein 184msl-2
  • RNF184

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45893
Species: Hu
Applications: WB, IHC
NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
H00010943-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
AF844
Species: Mu
Applications: WB, Block
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85341
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS5011
Species: Hu, Mk, Pm
Applications: IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46132
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-83853
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MSL2L1 Antibody (NBP1-83853)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ChIP, IP, WB.


Filter By Application
ChIP
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MSL2L1 Antibody (NBP1-83853) (0)

There are no reviews for MSL2L1 Antibody (NBP1-83853). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MSL2L1 Antibody (NBP1-83853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSL2L1 Products

Bioinformatics Tool for MSL2L1 Antibody (NBP1-83853)

Discover related pathways, diseases and genes to MSL2L1 Antibody (NBP1-83853). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSL2L1 Antibody (NBP1-83853)

Discover more about diseases related to MSL2L1 Antibody (NBP1-83853).
 

Pathways for MSL2L1 Antibody (NBP1-83853)

View related products by pathway.

PTMs for MSL2L1 Antibody (NBP1-83853)

Learn more about PTMs related to MSL2L1 Antibody (NBP1-83853).

Blogs on MSL2L1

There are no specific blogs for MSL2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSL2L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSL2