hnRNP-Q Antibody (1R0G5)

Western Blot: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Western blot analysis of extracts of various cell lines, using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/Immunofluorescence: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Immunofluorescence analysis of U-2 OS cells using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Immunohistochemistry of paraffin-embedded mouse brain using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Immunofluorescence analysis of C6 cells using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Immunofluorescence analysis of NIH-3T3 cells using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Immunohistochemistry of paraffin-embedded human liver cancer using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 1R0G5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

hnRNP-Q Antibody (1R0G5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP-Q (O60506). SQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SYNCRIP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for hnRNP-Q Antibody (1R0G5)

• dJ3J17.2
• Glycine- and tyrosine-rich RNA-binding protein
• GRYRBP
• GRY-RBPNS1-associated protein 1
• heterogeneous nuclear ribonucleoprotein Q
• hnRNP Q
• hnRNP-Q
• HNRPQ
• HNRPQ1
• NSAP1FLJ31626
• PP68
• synaptotagmin binding, cytoplasmic RNA interacting protein
• Synaptotagmin-binding, cytoplasmic RNA-interacting protein

Background

Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. Component of the CRD-mediated complex that promotes MYC mRNA stability. Isoform 1, isoform 2 and isoform 3 are associated in vitro with pre-mRNA, splicing intermediates and mature mRNA protein complexes. Isoform 1 binds to apoB mRNA AU-rich sequences. Isoform 1 is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. Isoform 3 may be involved in cytoplasmic vesicle-based mRNA transport through interaction with synaptotagmins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYNCRIP