CSDE1 Antibody (1N9F6)

Western Blot: CSDE1 Antibody (1N9F6) [NBP3-33278] - Western blot analysis of lysates from Mouse skeletal muscle, using CSDE1 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

Western Blot: CSDE1 Antibody (1N9F6) [NBP3-33278] - Western blot analysis of various lysates using CSDE1 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 1N9F6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CSDE1 Antibody (1N9F6) Summary

• Description: Novus Biologicals Rabbit CSDE1 Antibody (1N9F6) (NBP3-33278) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CSDE1 (NP_009089.4).
  
  Sequence:
  MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERM
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CSDE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 89 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CSDE1 Antibody (1N9F6)

• cold shock domain containing E1, RNA-binding
• cold shock domain-containing protein E1
• D1S155EUNRRP5-1000E10.3
• DKFZp779B0247
• DKFZp779J1455
• FLJ26882
• KIAA0885
• N-ras upstream gene protein
• NRAS-related
• NRU
• Protein UNR
• upstream of NRAS

Background

CSDE1, also known as Cold shock domain-containing protein E1, is a 798 amino acid long isoform that is 89 kDa and a short 767 amino acid isoform that is approx. 86 kDa, which is directly related to the translation of the human rhinovirus RNA as an RNA binding protein. Studies are being performed on the relationship of this protein to chronic lymphocytic leukemia, diamond-blackfan anemia, lymphocytic leukemia, breast cancer, and shock. CSDE1 protein involvement has been observed with relation to PCSK7, SYNCRIP, PABPC1, HNRNPD, PIK3R1 in the regulation of transcription DNA-dependent and male gonad development pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSDE1