CS Citrate Synthase Antibody (4Z10Z8)

Western Blot: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Western blot analysis of extracts of Rat heart cells, using CS Citrate Synthase antibody (NBP3-16438) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunofluorescence analysis of NIH-3T3 cells using CS Citrate Synthase Rabbit mAb (NBP3-16438) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded mouse kidney tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded rat colon tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded rat liver tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded human colon carcinoma tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 4Z10Z8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CS Citrate Synthase Antibody (4Z10Z8) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 367-466 of human CS Citrate Synthase (O75390). HLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CS Citrate Synthase Antibody (4Z10Z8)

• citrate (Si)-synthase
• citrate synthase
• citrate synthase, mitochondrial
• CS Citrate Synthase
• EC 2.3.3
• EC 2.3.3.1

Background

The protein encoded by the CS Citrate Synthase gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citratefrom oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. Thisprotein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CS