CRIP2 Antibody

Images

 
Western Blot: CRIP2 Antibody [NBP1-84379] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: CRIP2 Antibody [NBP1-84379] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & plasma membrane.
Immunohistochemistry-Paraffin: CRIP2 Antibody [NBP1-84379] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRIP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRIP2 Protein (NBP1-84379PEP)
Publications
Read Publication using NBP1-84379.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%). Reactivity reported in scientific literature (PMID: 22253135)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRIP2 Antibody

  • CRIP
  • CRP-2
  • CRP2ESP1
  • cysteine-rich protein 2
  • Cystein-rich intestinal protein
  • Protein ESP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84380
Species: Hu
Applications: IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBL1-09329
Species: Hu
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85446
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77341
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NBP1-88762
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4457
Species: Hu, Mu, Rt
Applications: WB

Publications for CRIP2 Antibody (NBP1-84379)(1)

Reviews for CRIP2 Antibody (NBP1-84379) (0)

There are no reviews for CRIP2 Antibody (NBP1-84379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRIP2 Antibody (NBP1-84379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRIP2 Products

Bioinformatics Tool for CRIP2 Antibody (NBP1-84379)

Discover related pathways, diseases and genes to CRIP2 Antibody (NBP1-84379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRIP2 Antibody (NBP1-84379)

Discover more about diseases related to CRIP2 Antibody (NBP1-84379).
 

Pathways for CRIP2 Antibody (NBP1-84379)

View related products by pathway.

PTMs for CRIP2 Antibody (NBP1-84379)

Learn more about PTMs related to CRIP2 Antibody (NBP1-84379).

Blogs on CRIP2

There are no specific blogs for CRIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRIP2