CEBP epsilon Antibody - BSA Free

Immunohistochemistry-Paraffin: CEBP epsilon Antibody [NBP1-85446] - Staining in human bone marrow and cerebral cortex tissues using anti-CEBPE antibody. Corresponding CEBPE RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: CEBP epsilon Antibody [NBP1-85446] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CEBP epsilon Antibody [NBP1-85446] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: CEBP epsilon Antibody [NBP1-85446] - Staining of human cerebral cortex shows low expression as expected.

Analysis in human cell line HL-60.

ChIP-Exo-Seq composite graph for Anti-CEBPE (NBP1-85446) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CEBP epsilon Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CEBP epsilon Antibody - BSA Free (NBP1-85446) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CEBP epsilon Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEBPE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CEBP epsilon Protein (NBP1-85446PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:31912614).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CEBP epsilon Antibody - BSA Free

• C/EBP-epsilon
• CCAAT/enhancer binding protein (C/EBP), epsilon
• CCAAT/enhancer-binding protein epsilon
• CEBP epsilon
• CEBPE
• CRP1C/EBP epsilon

Background

EBP1 (ErbB-3-binding protein 1), also known as PA2G4 (proliferation-associated 2G4), p38-2G4 or HG4-1, is a member of the peptidase M24C family and functions as an RNA-binding protein involved in cellular proliferation and differentiation processes. It is expressed in a variety of cell lines, including a wide range of tumor cell lines, and localizes to the cytoplasm. Upon treatment with Neuregulin-1 (heregulin), EBP1 translocates to the nucleus. EBP1 is a component of pre-ribosomal ribonucleoprotein complexes, participating in ribosome assembly and regulating the later steps of rRNA processing. In addition, EBP1 interacts with ErbB-3 and may function as a modulator of the ErbB-3-mediated signal transduction pathway by regulating the effects of Neuregulin-1. EBP1 also associates with histone deacetylases (HDACs), functioning as a transcriptional corepressor of cell cycle regulatory genes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CEBP epsilon Antibody (NBP1-85446)(3)

Publications using NBP1-85446

• Wesolowski R, Kowenz-Leutz E, Zimmermann K et al. Myeloid transformation by MLL-ENL depends strictly on C/EBP Life Sci Alliance 2021-01-01 [PMID: 33144337] (WB)
• Ishii H, Park WY, So J et al. Loss of myeloid-specific lamin A/C drives lung metastasis through Gfi-1 and C/EBP epsilon-mediated granulocytic differentiation Mol. Carcinog. 2020-01-07 [PMID: 31912614] (WB, Mouse)
• Kim HS, Oh SH, Kim JH et al. TRIB2 regulates the differentiation of MLL-TET1 transduced myeloid progenitor cells. J. Mol. Med. 2018-11-01 [PMID: 30324339] (WB, Human)

Bioinformatics

• Gene Symbol: CEBPE