CEBP epsilon Antibody

Images

 
Western Blot: CEBP epsilon Antibody [NBP1-85446] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: CEBP epsilon Antibody [NBP1-85446] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CEBP epsilon Antibody [NBP1-85446] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEBP epsilon Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEBPE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEBP epsilon Protein (NBP1-85446PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEBP epsilon Antibody

  • C/EBP-epsilon
  • CCAAT/enhancer binding protein (C/EBP), epsilon
  • CCAAT/enhancer-binding protein epsilon
  • CEBP epsilon
  • CEBPE
  • CRP1C/EBP epsilon

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-77341
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NBP1-84379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP1-88762
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow

Publications for CEBP epsilon Antibody (NBP1-85446) (0)

There are no publications for CEBP epsilon Antibody (NBP1-85446).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEBP epsilon Antibody (NBP1-85446) (0)

There are no reviews for CEBP epsilon Antibody (NBP1-85446). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEBP epsilon Antibody (NBP1-85446) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEBP epsilon Products

Bioinformatics Tool for CEBP epsilon Antibody (NBP1-85446)

Discover related pathways, diseases and genes to CEBP epsilon Antibody (NBP1-85446). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEBP epsilon Antibody (NBP1-85446)

Discover more about diseases related to CEBP epsilon Antibody (NBP1-85446).
 

Pathways for CEBP epsilon Antibody (NBP1-85446)

View related products by pathway.

PTMs for CEBP epsilon Antibody (NBP1-85446)

Learn more about PTMs related to CEBP epsilon Antibody (NBP1-85446).

Blogs on CEBP epsilon

There are no specific blogs for CEBP epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEBP epsilon Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEBPE
Entrez