CPSF6 Antibody - BSA Free

Images

 
CPSF6-Antibody-Western-Blot-NBP1-85676-img0018.jpg
CPSF6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85676-img0016.jpg
Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-85676] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.
Genetic Strategies: CPSF6-Antibody-Knockdown-Validated-NBP1-85676-img0017.jpg
Western Blot: CPSF6 Antibody [NBP1-85676] - CPSF6-358 inhibits HIV-1 replication when localized to the cytoplasm. (A) CPSF6 protein in TZM-bl cells transduced with empty, CPSF6-358, CPSF6-358 NLS & CPSF6-358 NES ...read more
Western Blot: CPSF6 Antibody [NBP1-85676] - HIV-1 replication is inhibited when full-length CPSF6 is targeted to the cytoplasm. (A) Expression levels of CPSF6 in TZM-bl cells transduced with empty, CPSF6, CPSF6-NLS & ...read more
Western Blot: CPSF6 Antibody [NBP1-85676] - HIV-1 replication is inhibited when full-length CPSF6 is targeted to the cytoplasm. (A) Expression levels of CPSF6 in TZM-bl cells transduced with empty, CPSF6, CPSF6-NLS & ...read more
Western Blot: CPSF6 Antibody [NBP1-85676] - The effect of CPSF6-358 on the infectivity of HIV-1 CA mutants correlates with the effect of TNPO3 KD. (A) Schematic representation of the protein domains of WT CPSF6 & the ...read more
Western Blot: CPSF6 Antibody [NBP1-85676] - TNPO3 depletion does not inhibit HIV-1 if CPSF6 is independently targeted to the nucleus. (A) CPSF6 & TNPO3 protein in TZM-bl cells stably transduced with CPSF6 KD vectors, ...read more
Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676] - TNPO3 depletion does not inhibit HIV-1 if CPSF6 is independently targeted to the nucleus. (A) CPSF6 & TNPO3 protein in TZM-bl cells stably ...read more
Staining of human colon shows strong nuclear positivity in glandular cells.
Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Analysis in human cell line HL-60.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, Mycoplasma
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
     

Genetic Strategies

   

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CPSF6 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPSF6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CPSF6 Protein (NBP1-85676PEP)
Publications
Read Publications using
NBP1-85676 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CPSF6 Antibody - BSA Free

  • CFIM
  • CFIm68
  • CFIM68CPSF 68 kDa subunit
  • CFIMcleavage and polyadenylation specific factor 6, 68kD subunit
  • cleavage and polyadenylation specific factor 6, 68kDa
  • Cleavage and polyadenylation specificity factor 68 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 6
  • HPBRII-4
  • HPBRII-7
  • pre-mRNA cleavage factor I, 68kD subunit
  • pre-mRNA cleavage factor Im (68kD)
  • Pre-mRNA cleavage factor Im 68 kDa subunit
  • Protein HPBRII-4/7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-33527
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-46276
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16561
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
NB100-61600
Species: Hu, Ma, Pm
Applications: IHC,  IHC-P, IP, WB
NBP1-28912
Species: Rt
Applications: PEP-ELISA, WB
NBP1-91011
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-94173
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-22286
Species: Hu, Mu
Applications: IP, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for CPSF6 Antibody (NBP1-85676)(6)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 6 applications: ICC/IF, IF/IHC, Immunocytochemistry/ Immunofluorescence, KD, WB, Western Blot.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
Immunocytochemistry/ Immunofluorescence
(3)
KD
(1)
WB
(1)
Western Blot
(3)
All Applications
Filter By Species
Human
(6)
All Species
Showing Publications 1 - 6 of 6.
Publications using NBP1-85676 Applications Species
Liu S, Wu R, Chen L et al. CPSF6 regulates alternative polyadenylation and proliferation of cancer cells through phase separation Cell reports 2023-10-31 [PMID: 37777964] (KD, Human) KD Human
Scoca V, Morin R, Collard M et al. HIV-induced membraneless organelles orchestrate post-nuclear entry steps Journal of Molecular Cell Biology 2023-04-06 [PMID: 36314049] (Western Blot, Immunocytochemistry/ Immunofluorescence, Human) Western Blot, Immunocytochemistry/ Immunofluorescence Human
Hu Z, Li M, Huo Z et al. U1 snRNP proteins promote proximal alternative polyadenylation sites by directly interacting with 3' end processing core factors Journal of Molecular Cell Biology 2022-12-26 [PMID: 36073763] (Western Blot, Immunocytochemistry/ Immunofluorescence, Human) Western Blot, Immunocytochemistry/ Immunofluorescence Human
Zhong Z, Ning J, Boggs EA et al. Cytoplasmic CPSF6 Regulates HIV-1 Capsid Trafficking and Infection in a Cyclophilin A-Dependent Manner mBio 2021-04-27 [PMID: 33758083] (Western Blot, Immunocytochemistry/ Immunofluorescence, Human) Western Blot, Immunocytochemistry/ Immunofluorescence Human
Peng K, Muranyi W, Glass B et al. Quantitative microscopy of functional HIV post-entry complexes reveals association of replication with the viral capsid. eLife 2014-12-17 [PMID: 25517934] (IF/IHC, Human) IF/IHC Human
De Iaco A, Santoni F, Vannier A et al. TNPO3 protects HIV-1 replication from CPSF6-mediated capsid stabilization in the host cell cytoplasm. Retrovirology 2013-02-15 [PMID: 23414560] (WB, ICC/IF, Human) WB, ICC/IF Human

Reviews for CPSF6 Antibody (NBP1-85676) (0)

There are no reviews for CPSF6 Antibody (NBP1-85676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CPSF6 Antibody (NBP1-85676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPSF6 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CPSF6