| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CPSF6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CPSF6 |
![Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CPSF6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85676-img0010.jpg "Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear speckles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-85676] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/CPSF6-Antibody-Immunohistochemistry-Paraffin-NBP1-85676-img0012.jpg "Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-85676] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.")
![Western Blot: CPSF6 Antibody [NBP1-85676] - CPSF6-358 inhibits HIV-1 replication when localized to the cytoplasm. (A) CPSF6 protein in TZM-bl cells transduced with empty, CPSF6-358, CPSF6-358 NLS & CPSF6-358 NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous CPSF6 & the truncated form. (B) Indirect immunofluorescence showing localization of the different forms of CPSF6-358. The TZM-bl cells, transduced as in (A), were stained with an anti-HA antibody (green) for the detection of the CPSF6-358 proteins. DAPI was used to mark the nuclear compartment (blue). (C) TZM-bl stably expressing the different forms of CPSF6-358 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85676_rabbit-polyclonal-cpsf6-antibody-31020241612239.jpg "Western Blot: CPSF6 Antibody [NBP1-85676] - CPSF6-358 inhibits HIV-1 replication when localized to the cytoplasm. (A) CPSF6 protein in TZM-bl cells transduced with empty, CPSF6-358, CPSF6-358 NLS & CPSF6-358 NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous CPSF6 & the truncated form. (B) Indirect immunofluorescence showing localization of the different forms of CPSF6-358. The TZM-bl cells, transduced as in (A), were stained with an anti-HA antibody (green) for the detection of the CPSF6-358 proteins. DAPI was used to mark the nuclear compartment (blue). (C) TZM-bl stably expressing the different forms of CPSF6-358 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: CPSF6 Antibody [NBP1-85676] - HIV-1 replication is inhibited when full-length CPSF6 is targeted to the cytoplasm. (A) Expression levels of CPSF6 in TZM-bl cells transduced with empty, CPSF6, CPSF6-NLS & CPSF6-NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous & exogenous full-length CPSF6 with an HA tag. (B) Localization of different forms of CPSF6 in TZM-bl cells stably expressing CPSF6, CPSF6 NLS or CPSF6 NES. The cells were stained with an anti-HA antibody (green) for the detection of the CPSF6 proteins. DAPI staining (blue) was used to mark the nuclear compartment. (C) TZM-bl stably expressing the different forms of CPSF6 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hours, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85676_rabbit-polyclonal-cpsf6-antibody-3102024161221.jpg "Western Blot: CPSF6 Antibody [NBP1-85676] - HIV-1 replication is inhibited when full-length CPSF6 is targeted to the cytoplasm. (A) Expression levels of CPSF6 in TZM-bl cells transduced with empty, CPSF6, CPSF6-NLS & CPSF6-NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous & exogenous full-length CPSF6 with an HA tag. (B) Localization of different forms of CPSF6 in TZM-bl cells stably expressing CPSF6, CPSF6 NLS or CPSF6 NES. The cells were stained with an anti-HA antibody (green) for the detection of the CPSF6 proteins. DAPI staining (blue) was used to mark the nuclear compartment. (C) TZM-bl stably expressing the different forms of CPSF6 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hours, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: CPSF6 Antibody [NBP1-85676] - HIV-1 replication is inhibited when full-length CPSF6 is targeted to the cytoplasm. (A) Expression levels of CPSF6 in TZM-bl cells transduced with empty, CPSF6, CPSF6-NLS & CPSF6-NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous & exogenous full-length CPSF6 with an HA tag. (B) Localization of different forms of CPSF6 in TZM-bl cells stably expressing CPSF6, CPSF6 NLS or CPSF6 NES. The cells were stained with an anti-HA antibody (green) for the detection of the CPSF6 proteins. DAPI staining (blue) was used to mark the nuclear compartment. (C) TZM-bl stably expressing the different forms of CPSF6 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hours, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85676_rabbit-polyclonal-cpsf6-antibody-31020241612232.jpg "Western Blot: CPSF6 Antibody [NBP1-85676] - HIV-1 replication is inhibited when full-length CPSF6 is targeted to the cytoplasm. (A) Expression levels of CPSF6 in TZM-bl cells transduced with empty, CPSF6, CPSF6-NLS & CPSF6-NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous & exogenous full-length CPSF6 with an HA tag. (B) Localization of different forms of CPSF6 in TZM-bl cells stably expressing CPSF6, CPSF6 NLS or CPSF6 NES. The cells were stained with an anti-HA antibody (green) for the detection of the CPSF6 proteins. DAPI staining (blue) was used to mark the nuclear compartment. (C) TZM-bl stably expressing the different forms of CPSF6 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hours, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: CPSF6 Antibody [NBP1-85676] - The effect of CPSF6-358 on the infectivity of HIV-1 CA mutants correlates with the effect of TNPO3 KD. (A) Schematic representation of the protein domains of WT CPSF6 & the truncated mutant CPSF6-358. RNA recognition motif (RRM), proline-rich domain (P-rich), arginine/serine rich domain (RS). (B) Expression levels of CPSF6 in TZM-bl cells transduced with empty or CPSF6-358 vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous CPSF6 & the truncated form. (C) TZM-bl cells transduced with an empty vector or with a vector encoding CPSF6-358 were challenged with a panel of 27 HIV-1-GFP reporter vectors bearing either WT CA or the indicated CA mutants. At 72 hrs the percent GFP+ cells was determined by flow cytometry as an indication of infectivity. The ratio of HIV-1 infectivity in CPSF6-358 expressing cells & empty vector cells is shown. White bars show CA mutants inhibited to a similar extent as the WT virus by CPSF6-358, black bars shows CA mutants insensitive or slightly sensitive to CPSF6-358, & gray bars show CA mutants hypersensitive to the presence of CPSF6-358 in the cell. (D) Correlation between the infectivity ratios of the 27 CA mutants when infecting Ctrl KD vs TNPO3 KD [8] & Empty vector vs CPSF6-358 (R2 = 0.8528). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85676_rabbit-polyclonal-cpsf6-antibody-310202416121945.jpg "Western Blot: CPSF6 Antibody [NBP1-85676] - The effect of CPSF6-358 on the infectivity of HIV-1 CA mutants correlates with the effect of TNPO3 KD. (A) Schematic representation of the protein domains of WT CPSF6 & the truncated mutant CPSF6-358. RNA recognition motif (RRM), proline-rich domain (P-rich), arginine/serine rich domain (RS). (B) Expression levels of CPSF6 in TZM-bl cells transduced with empty or CPSF6-358 vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous CPSF6 & the truncated form. (C) TZM-bl cells transduced with an empty vector or with a vector encoding CPSF6-358 were challenged with a panel of 27 HIV-1-GFP reporter vectors bearing either WT CA or the indicated CA mutants. At 72 hrs the percent GFP+ cells was determined by flow cytometry as an indication of infectivity. The ratio of HIV-1 infectivity in CPSF6-358 expressing cells & empty vector cells is shown. White bars show CA mutants inhibited to a similar extent as the WT virus by CPSF6-358, black bars shows CA mutants insensitive or slightly sensitive to CPSF6-358, & gray bars show CA mutants hypersensitive to the presence of CPSF6-358 in the cell. (D) Correlation between the infectivity ratios of the 27 CA mutants when infecting Ctrl KD vs TNPO3 KD [8] & Empty vector vs CPSF6-358 (R2 = 0.8528). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: CPSF6 Antibody [NBP1-85676] - TNPO3 depletion does not inhibit HIV-1 if CPSF6 is independently targeted to the nucleus. (A) CPSF6 & TNPO3 protein in TZM-bl cells stably transduced with CPSF6 KD vectors, control or TNPO3 KD vectors, & rescue of CPSF6 (ntCPSF6) with or without the SV40 T-Ag NLS. Cell lysate was probed in western blots with anti-TNPO3 antibody (upper panel), anti-CPSF6 antibody (middle panel) & anti-beta -actin antibody (lower panel). (B) Localization of the non-targetable CPSF6 (ntCPSF6) constructs (green) in control (Ctrl) KD or TNPO3 KD TZM-bl cells stably depleted of CPSF6. DAPI staining (blue) was used to mark the nuclear compartment. (C) The pools of stable cell lines in (B) were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP expression was checked by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85676_rabbit-polyclonal-cpsf6-antibody-31020241613648.jpg "Western Blot: CPSF6 Antibody [NBP1-85676] - TNPO3 depletion does not inhibit HIV-1 if CPSF6 is independently targeted to the nucleus. (A) CPSF6 & TNPO3 protein in TZM-bl cells stably transduced with CPSF6 KD vectors, control or TNPO3 KD vectors, & rescue of CPSF6 (ntCPSF6) with or without the SV40 T-Ag NLS. Cell lysate was probed in western blots with anti-TNPO3 antibody (upper panel), anti-CPSF6 antibody (middle panel) & anti-beta -actin antibody (lower panel). (B) Localization of the non-targetable CPSF6 (ntCPSF6) constructs (green) in control (Ctrl) KD or TNPO3 KD TZM-bl cells stably depleted of CPSF6. DAPI staining (blue) was used to mark the nuclear compartment. (C) The pools of stable cell lines in (B) were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP expression was checked by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676] - TNPO3 depletion does not inhibit HIV-1 if CPSF6 is independently targeted to the nucleus. (A) CPSF6 & TNPO3 protein in TZM-bl cells stably transduced with CPSF6 KD vectors, control or TNPO3 KD vectors, & rescue of CPSF6 (ntCPSF6) with or without the SV40 T-Ag NLS. Cell lysate was probed in western blots with anti-TNPO3 antibody (upper panel), anti-CPSF6 antibody (middle panel) & anti-beta -actin antibody (lower panel). (B) Localization of the non-targetable CPSF6 (ntCPSF6) constructs (green) in control (Ctrl) KD or TNPO3 KD TZM-bl cells stably depleted of CPSF6. DAPI staining (blue) was used to mark the nuclear compartment. (C) The pools of stable cell lines in (B) were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP expression was checked by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85676_rabbit-polyclonal-cpsf6-antibody-310202416121927.jpg "Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676] - TNPO3 depletion does not inhibit HIV-1 if CPSF6 is independently targeted to the nucleus. (A) CPSF6 & TNPO3 protein in TZM-bl cells stably transduced with CPSF6 KD vectors, control or TNPO3 KD vectors, & rescue of CPSF6 (ntCPSF6) with or without the SV40 T-Ag NLS. Cell lysate was probed in western blots with anti-TNPO3 antibody (upper panel), anti-CPSF6 antibody (middle panel) & anti-beta -actin antibody (lower panel). (B) Localization of the non-targetable CPSF6 (ntCPSF6) constructs (green) in control (Ctrl) KD or TNPO3 KD TZM-bl cells stably depleted of CPSF6. DAPI staining (blue) was used to mark the nuclear compartment. (C) The pools of stable cell lines in (B) were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP expression was checked by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (//retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Western_Blot_15520.jpg)
![Immunohistochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunohistochemistry_7155.jpg)
![Immunocytochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunocytochemistry__Immunofluorescence_23051.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Western_Blot_5320.jpg)
![Intracellular Staining by Flow Cytometry Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Flow_Cytometry_20834.jpg)
![Chromatin Immunoprecipitation (ChIP) Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Chromatin_Immunoprecipitation_11236.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")