CPSF6 Antibody


Western Blot: CPSF6 Antibody [NBP1-85676] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear speckles.
Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-85676] - Staining of human breast shows strong nuclear positivity in glandular cells.
Western Blot: CPSF6 Antibody [NBP1-85676] - Analysis in human cell line HL-60.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CPSF6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CPSF6 Protein (NBP1-85676PEP)
Read Publications using
NBP1-85676 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25517934).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CPSF6 Antibody

  • CFIM
  • CFIm68
  • CFIM68CPSF 68 kDa subunit
  • CFIMcleavage and polyadenylation specific factor 6, 68kD subunit
  • cleavage and polyadenylation specific factor 6, 68kDa
  • Cleavage and polyadenylation specificity factor 68 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 6
  • HPBRII-4
  • HPBRII-7
  • pre-mRNA cleavage factor I, 68kD subunit
  • pre-mRNA cleavage factor Im (68kD)
  • Pre-mRNA cleavage factor Im 68 kDa subunit
  • Protein HPBRII-4/7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CPSF6 Antibody (NBP1-85676)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for CPSF6 Antibody (NBP1-85676) (0)

There are no reviews for CPSF6 Antibody (NBP1-85676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CPSF6 Antibody (NBP1-85676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CPSF6 Products

Bioinformatics Tool for CPSF6 Antibody (NBP1-85676)

Discover related pathways, diseases and genes to CPSF6 Antibody (NBP1-85676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPSF6 Antibody (NBP1-85676)

Discover more about diseases related to CPSF6 Antibody (NBP1-85676).

Pathways for CPSF6 Antibody (NBP1-85676)

View related products by pathway.

PTMs for CPSF6 Antibody (NBP1-85676)

Learn more about PTMs related to CPSF6 Antibody (NBP1-85676).

Blogs on CPSF6

There are no specific blogs for CPSF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CPSF6 Antibody and receive a gift card or discount.


Gene Symbol CPSF6