SFPQ Antibody (8Y5S6)

Western Blot: SFPQ Antibody (8Y5S6) [NBP3-33527] - Western blot analysis of various lysates using SFPQ Rabbit mAb at 1:200 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of HeLa cells using SFPQ Rabbit mAb (A3494) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of C6 cells using SFPQ Rabbit mAb (A3494) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of NIH-3T3 cells using SFPQ Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clone: 8Y5S6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SFPQ Antibody (8Y5S6) Summary

• Description: Novus Biologicals Rabbit SFPQ Antibody (8Y5S6) (NBP3-33527) is a monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-707 of human SFPQ (P23246).
  
  Sequence:
  MGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SFPQ
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:50 - 1:200
• Theoretical MW: 76 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SFPQ Antibody (8Y5S6)

• 100 kDa DNA-pairing protein
• DNA-binding p52/p100 complex, 100 kDa subunit
• hPOMp100
• polypyrimidine tract binding protein associated
• polypyrimidine tract-binding protein-associated splicing factor
• Polypyrimidine tract-binding protein-associated-splicing factor
• PSFPOMP100
• PTB-associated splicing factor
• PTB-associated-splicing factor
• splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated)
• splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated)
• splicing factor proline/glutamine-rich
• splicing factor, proline- and glutamine-rich

Background

PSF/SFPQ is a multifunctional protein know to participate in a variety of nuclear processes and may function to link transcription and pre-mRNA processing. PSF/SFPQ bears an RNA recognition motif (RRM) further indicating its role in post-transcriptional processes. PSF has been shown to associate with p54nrb/NonO to modulate androgen receptor-mediated transcription. Additionally, it has recently been show to associate with XRN2 and p54nrb/NonO to facilitate pre-mRNA 3' processing and transcription termination. Alternate names for PSF/SFPQ include polypyrimidine tract-binding protein-associated-splicing factor, PTB-associated-splicing factor, splicing factor proline-and glutamine-rich, and POMP100.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SFPQ