SFPQ Antibody (8Y5S6)

Images

 
Western Blot: SFPQ Antibody (8Y5S6) [NBP3-33527] - Western blot analysis of various lysates using SFPQ Rabbit mAb at 1:200 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of HeLa cells using SFPQ Rabbit mAb (A3494) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated ...read more
Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of C6 cells using SFPQ Rabbit mAb (A3494) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval ...read more
Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of NIH-3T3 cells using SFPQ Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP
Clone
8Y5S6
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFPQ Antibody (8Y5S6) Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 600-707 of human SFPQ (P23246).

Sequence:
MGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
SFPQ
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:50 - 1:200
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SFPQ Antibody (8Y5S6)

  • 100 kDa DNA-pairing protein
  • DNA-binding p52/p100 complex, 100 kDa subunit
  • hPOMp100
  • polypyrimidine tract binding protein associated
  • polypyrimidine tract-binding protein-associated splicing factor
  • Polypyrimidine tract-binding protein-associated-splicing factor
  • PSFPOMP100
  • PTB-associated splicing factor
  • PTB-associated-splicing factor
  • splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated)
  • splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated)
  • splicing factor proline/glutamine-rich
  • splicing factor, proline- and glutamine-rich

Background

PSF/SFPQ is a multifunctional protein know to participate in a variety of nuclear processes and may function to link transcription and pre-mRNA processing. PSF/SFPQ bears an RNA recognition motif (RRM) further indicating its role in post-transcriptional processes. PSF has been shown to associate with p54nrb/NonO to modulate androgen receptor-mediated transcription. Additionally, it has recently been show to associate with XRN2 and p54nrb/NonO to facilitate pre-mRNA 3' processing and transcription termination. Alternate names for PSF/SFPQ include polypyrimidine tract-binding protein-associated-splicing factor, PTB-associated-splicing factor, splicing factor proline-and glutamine-rich, and POMP100.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-31164
Species: Hu
Applications: ICC/IF, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87381
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-83801
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
664-LI
Species: Hu
Applications: BA
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
203-IL
Species: Hu
Applications: BA
291-G1
Species: Hu
Applications: BA
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP3-41367
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP3-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for SFPQ Antibody (NBP3-33527) (0)

There are no publications for SFPQ Antibody (NBP3-33527).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFPQ Antibody (NBP3-33527) (0)

There are no reviews for SFPQ Antibody (NBP3-33527). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFPQ Antibody (NBP3-33527) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFPQ Products

Research Areas for SFPQ Antibody (NBP3-33527)

Find related products by research area.

Blogs on SFPQ

There are no specific blogs for SFPQ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFPQ Antibody (8Y5S6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SFPQ