Corticotropin Releasing Factor Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human Corticotropin Releasing Factor (NP_000747.1). LLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CRH |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 -1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Corticotropin Releasing Factor Antibody - BSA Free
Background
Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH issecreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH hasbeen observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency hasmultiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to productionin the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed inthe placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturitionand delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, inaddition to its metabolic functions, CRH may act as a trigger for parturition. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Bv, Ca, Ch, Hu, Ma, Mu, Rt
Applications: ICC/IF, Simple Western, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Publications for Corticotropin Releasing Factor Antibody (NBP3-15356) (0)
There are no publications for Corticotropin Releasing Factor Antibody (NBP3-15356).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Corticotropin Releasing Factor Antibody (NBP3-15356) (0)
There are no reviews for Corticotropin Releasing Factor Antibody (NBP3-15356).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Corticotropin Releasing Factor Antibody (NBP3-15356) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Corticotropin Releasing Factor Products
Research Areas for Corticotropin Releasing Factor Antibody (NBP3-15356)
Find related products by research area.
|
Blogs on Corticotropin Releasing Factor