Collectrin/TMEM27 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Collectrin/TMEM27 Antibody [NBP2-13450] - Immunofluorescent staining of human cell line HaCaT shows localization to endoplasmic reticulum & vesicles.
Immunohistochemistry-Paraffin: Collectrin/TMEM27 Antibody [NBP2-13450] - Staining of human kidney shows weak luminal membranous and cytoplasmic positivity in renal tubules.
Immunohistochemistry-Paraffin: Collectrin/TMEM27 Antibody [NBP2-13450] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Collectrin/TMEM27 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFS MRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRM NKNRINNAFFLNDQTLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Collectrin/TMEM27 Protein (NBP2-13450PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collectrin/TMEM27 Antibody

  • Collectrin
  • kidney-specific membrane protein
  • NX17
  • NX-17
  • TMEM27
  • transmembrane protein 27NX170610008J07Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86277
Species: Hu
Applications: IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-92414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-82024
Species: Hu
Applications: IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000486-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF7318
Species: Hu
Applications: IHC
AF3646
Species: Hu
Applications: WB, ICC
AF3444
Species: Hu
Applications: WB

Publications for Collectrin/TMEM27 Antibody (NBP2-13450) (0)

There are no publications for Collectrin/TMEM27 Antibody (NBP2-13450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collectrin/TMEM27 Antibody (NBP2-13450) (0)

There are no reviews for Collectrin/TMEM27 Antibody (NBP2-13450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Collectrin/TMEM27 Antibody (NBP2-13450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collectrin/TMEM27 Products

Bioinformatics Tool for Collectrin/TMEM27 Antibody (NBP2-13450)

Discover related pathways, diseases and genes to Collectrin/TMEM27 Antibody (NBP2-13450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collectrin/TMEM27 Antibody (NBP2-13450)

Discover more about diseases related to Collectrin/TMEM27 Antibody (NBP2-13450).
 

Pathways for Collectrin/TMEM27 Antibody (NBP2-13450)

View related products by pathway.

PTMs for Collectrin/TMEM27 Antibody (NBP2-13450)

Learn more about PTMs related to Collectrin/TMEM27 Antibody (NBP2-13450).

Blogs on Collectrin/TMEM27

There are no specific blogs for Collectrin/TMEM27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collectrin/TMEM27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM27
Entrez