SLC6A18 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC6A18 Antibody [NBP1-82024] - Staining in human kidney and lymph node tissues using anti-SLC6A18 antibody. Corresponding SLC6A18 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: SLC6A18 Antibody [NBP1-82024] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC6A18 Antibody [NBP1-82024] - Staining of human kidney shows moderate luminal membranous positivity in renal tubules..

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC6A18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC6A18 Protein (NBP1-82024PEP)
Publications
Read Publication using NBP1-82024.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (81%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC6A18 Antibody

  • FLJ31236
  • Sodium- and chloride-dependent transporter XTRP2
  • sodium channel-like protein
  • sodium-dependent neutral amino acid transporter B(0)AT3
  • solute carrier family 6 (neurotransmitter transporter), member 18
  • Solute carrier family 6 member 18
  • solute carrier family 6, member 18
  • System B(0) neutral amino acid transporter AT3
  • XTRP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48784
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00054716-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-33208
Species: Hu
Applications: ICC/IF, WB
H00009197-M07
Species: Ha, Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
NBP1-77078
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
AF4965
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-92853
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5016
Species: Hu
Applications: WB
NBP2-76966
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB660
Species: Hu
Applications: IHC
NBP1-59418
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84378
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NB100-81029
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for SLC6A18 Antibody (NBP1-82024)(1)

Reviews for SLC6A18 Antibody (NBP1-82024) (0)

There are no reviews for SLC6A18 Antibody (NBP1-82024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC6A18 Antibody (NBP1-82024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC6A18 Products

Bioinformatics Tool for SLC6A18 Antibody (NBP1-82024)

Discover related pathways, diseases and genes to SLC6A18 Antibody (NBP1-82024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A18 Antibody (NBP1-82024)

Discover more about diseases related to SLC6A18 Antibody (NBP1-82024).
 

Pathways for SLC6A18 Antibody (NBP1-82024)

View related products by pathway.

PTMs for SLC6A18 Antibody (NBP1-82024)

Learn more about PTMs related to SLC6A18 Antibody (NBP1-82024).
 

Research Areas for SLC6A18 Antibody (NBP1-82024)

Find related products by research area.

Blogs on SLC6A18

There are no specific blogs for SLC6A18, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A18