FXYD2 Antibody (1C3-B3)


Western Blot: FXYD2 Antibody (1C3-B3) [H00000486-M01] - FXYD2 monoclonal antibody (M01), clone 1C3-B3 Analysis of FXYD2 expression in Jurkat.
Immunohistochemistry-Paraffin: FXYD2 Antibody (1C3-B3) [H00000486-M01] - Analysis of monoclonal antibody to FXYD2 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
Sandwich ELISA Capture: FXYD2 Antibody (1C3-B3) [H00000486-M01] - Detection limit for recombinant GST tagged FXYD2 is 0.3 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA, ELISA(Cap)

Order Details

FXYD2 Antibody (1C3-B3) Summary

FXYD2 (AAH05302.1, 1 a.a. ~ 64 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
FXYD2 - FXYD domain containing ion transport regulator 2
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
  • Sandwich ELISA Capture
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Read Publications using H00000486-M01.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FXYD2 Antibody (1C3-B3)

  • ATP1C
  • ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide
  • FXYD domain containing ion transport regulator 2
  • FXYD domain-containing ion transport regulator 2
  • HOMG2
  • hypomagnesemia 2, renal
  • MGC12372
  • Na(+)/K(+) ATPase subunit gamma
  • Sodium pump gamma chain
  • sodium/potassium-transporting ATPase subunit gamma
  • Sodium-potassium-ATPase, gamma polypeptide


This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The Type III integral membrane protein encoded by this gene is the gamma subunit of the Na,K-ATPase present on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Mutations in this gene have been associated with renal hypomagnesaemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC
Species: Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA, ELISA(Cap)

Publications for FXYD2 Antibody (H00000486-M01)(2)

Reviews for FXYD2 Antibody (H00000486-M01) (0)

There are no reviews for FXYD2 Antibody (H00000486-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FXYD2 Antibody (H00000486-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FXYD2 Products

Bioinformatics Tool for FXYD2 Antibody (H00000486-M01)

Discover related pathways, diseases and genes to FXYD2 Antibody (H00000486-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXYD2 Antibody (H00000486-M01)

Discover more about diseases related to FXYD2 Antibody (H00000486-M01).

Pathways for FXYD2 Antibody (H00000486-M01)

View related products by pathway.

PTMs for FXYD2 Antibody (H00000486-M01)

Learn more about PTMs related to FXYD2 Antibody (H00000486-M01).

Blogs on FXYD2

There are no specific blogs for FXYD2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FXYD2 Antibody (1C3-B3) and receive a gift card or discount.


Gene Symbol FXYD2