Collagen III alpha 1/COL3A1 Antibody

Images

 
Orthogonal Strategies: Western Blot: Collagen III alpha 1/COL3A1 Antibody [NBP1-84007] - Analysis in human cell lines HeLa and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading ...read more
Immunohistochemistry-Paraffin: Collagen III alpha 1/COL3A1 Antibody [NBP1-84007] - Staining of human endometrium shows weak to moderate cytoplasmic positivity in stromal cells.
Immunohistochemistry-Paraffin: Collagen III alpha 1/COL3A1 Antibody [NBP1-84007] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Collagen III alpha 1/COL3A1 Antibody [NBP1-84007] - Staining of human colorectal cancer shows weak to moderate cytoplasmic positivity in stromal cells.
Immunohistochemistry-Paraffin: Collagen III alpha 1/COL3A1 Antibody [NBP1-84007] - Staining of human skin shows weak to moderate cytoplasmic positivity in fibroblasts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Collagen III alpha 1/COL3A1 Antibody Summary

Immunogen
This Collagen III alpha 1/COL3A1 Antibody was developed against a recombinant protein corresponding to amino acids: RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL3A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
139 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Collagen III alpha 1/COL3A1 Recombinant Protein Antigen (NBP1-84007PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen III alpha 1/COL3A1 Antibody

  • alpha1 (III) collagen
  • alpha-1 type III collagen
  • COL3A1
  • Collagen 3
  • collagen alpha-1(III) chain
  • Collagen III alpha 1
  • collagen, fetal
  • collagen, type III, alpha 1
  • Collagen-3
  • collagenIII
  • Collagen-III
  • EDS4A
  • EDSVASC
  • Ehlers-Danlos syndrome type IV, autosomal dominant
  • FLJ34534
  • PMGEDSV

Background

Collagen III alpha 1, also referred to as collagen type III alpha 1 or COL3A1 for short, was first described in 1971 and is a member of the collagen superfamily and encoded COL3A1 gene (1, 2). In general, collagen III is an extracellular matrix protein that is synthesized as a preprocollagen followed by cleaving of the signal peptide to form the procollagen (1). The human COL3A1 gene is located on chromosome 2q32.2 and collagen III is synthesized as a homotrimer consisting of three identical alpha procollagen chains which are stabilized by disulfide bonds (1,2,3). Each alpha chain is 1466 amino acids (aa) in length with a theoretical molecular weight of 139 kDa for a single alpha chain (1). Structurally, each alpha chain is a left-handed helix which then join together to form a right-handed triple helix (1,2). C-terminal and N-terminal proteinases remove the globular ends of the procollagen to form the type III collagen (1).

Collagen III is a fibrillar collagen that constitutes 5-20% of all collagen in the body (1). It provides structural integrity and is found in many hallow organs and soft connective tissue including the vascular system, skin, lung, uterus, and intestine (1,2). Additionally, collagen III has be found to be associated with type I collagen in the same fibrils (1). Collagen III interacts with signaling integrins to carry out other key functions including cell adhesion, proliferation, and differentiation (1).

Mutations in the COL3A1 gene has been associated with a variety of human diseases, the most well-known being a group of connective tissue disorders termed Ehlers-Danlos Syndromes (1,2,4). Vascular Ehlers-Danlos Syndrome is a specific subtype that is considered the most severe and although the clinical manifestations vary, symptoms include thin skin and fragile blood vessels and can often result in both lung and heart complications (1,4). COL3A1 is also associated with glomerulopathies, or diseases of the glomeruli, which are characterized by an abundance of extracellular matrix (3). Collagenofibrotic glomerulopathy is one specific rare renal disease that is characterized by excessive levels of collagen III (3).

References

1. Kuivaniemi, H., & Tromp, G. (2019). Type III collagen (COL3A1): Gene and protein structure, tissue distribution, and associated diseases. Gene. https://doi.org/10.1016/j.gene.2019.05.003

2. Ricard-Blum S. (2011). The collagen family. Cold Spring Harbor perspectives in biology. https://doi.org/10.1101/cshperspect.a004978

3. Cohen A. H. (2012). Collagen Type III Glomerulopathies. Advances in chronic kidney disease. https://doi.org/10.1053/j.ackd.2012.02.017

4. Olson, S. L., Murray, M. L., & Skeik, N. (2019). A Novel Frameshift COL3A1 Variant in Vascular Ehlers-Danlos Syndrome. Annals of vascular surgery. https://doi.org/10.1016/j.avsg.2019.05.057

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-408
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, Flow, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PAGE, WB
NBP2-92790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00001290-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-05118
Species: Bv, Ca, Ch(-), Gp(-), Hu, Ma, Mu(-), Po, Rb, Rt(-), Sh
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
DTM100
Species: Hu
Applications: ELISA
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-8146
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
7754-BH/CF
Species: Hu
Applications: BA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
DM1300
Species: Hu
Applications: ELISA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP1-26549
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF143
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-97126
Species: Hu
Applications: IHC, IHC-P, IP, WB
DMP300
Species: Hu
Applications: ELISA
AF3025
Species: Hu
Applications: ELISA, ICC, WB

Publications for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007) (0)

There are no publications for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007) (0)

There are no reviews for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen III alpha 1/COL3A1 Products

Bioinformatics Tool for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007)

Discover related pathways, diseases and genes to Collagen III alpha 1/COL3A1 Antibody (NBP1-84007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007)

Discover more about diseases related to Collagen III alpha 1/COL3A1 Antibody (NBP1-84007).
 

Pathways for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007)

View related products by pathway.

PTMs for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007)

Learn more about PTMs related to Collagen III alpha 1/COL3A1 Antibody (NBP1-84007).
 

Research Areas for Collagen III alpha 1/COL3A1 Antibody (NBP1-84007)

Find related products by research area.

Blogs on Collagen III alpha 1/COL3A1

There are no specific blogs for Collagen III alpha 1/COL3A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen III alpha 1/COL3A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL3A1
Entrez
Uniprot