COL1A2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COL1A2 Antibody [NBP2-58529] - Staining of human cell line BJ shows localization to endoplasmic reticulum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COL1A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYAS
Specificity
Specificity of human COL1A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL1A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COL1A2 Recombinant Protein Antigen (NBP2-58529PEP)

Reactivity Notes

Mouse 83%, Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for COL1A2 Antibody

  • alpha 2(I)-collagen
  • Alpha-2 type I collagen
  • collagen alpha-2(I) chain
  • collagen I, alpha-2 polypeptide
  • collagen of skin, tendon and bone, alpha-2 chain
  • collagen, type I, alpha 2
  • OI4
  • osteogenesis imperfecta type IV
  • type I procollagen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Fe, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
NBP2-35212
Species: Hu
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
AF1927
Species: Hu
Applications: WB, IP, ICC
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for COL1A2 Antibody (NBP2-58529) (0)

There are no publications for COL1A2 Antibody (NBP2-58529).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL1A2 Antibody (NBP2-58529) (0)

There are no reviews for COL1A2 Antibody (NBP2-58529). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COL1A2 Antibody (NBP2-58529) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for COL1A2 Antibody (NBP2-58529)

Discover related pathways, diseases and genes to COL1A2 Antibody (NBP2-58529). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL1A2 Antibody (NBP2-58529)

Discover more about diseases related to COL1A2 Antibody (NBP2-58529).
 

Pathways for COL1A2 Antibody (NBP2-58529)

View related products by pathway.

PTMs for COL1A2 Antibody (NBP2-58529)

Learn more about PTMs related to COL1A2 Antibody (NBP2-58529).

Blogs on COL1A2

There are no specific blogs for COL1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL1A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL1A2