COASY Antibody

Images

 
Western Blot: COASY Antibody [NBP1-84991] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: COASY Antibody [NBP1-84991] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: COASY Antibody [NBP1-84991] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COASY Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELPTCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGIINRKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COASY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COASY Protein (NBP1-84991PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COASY Antibody

  • bifunctional phosphopantetheine adenylyl transferase/dephospho CoA kinase
  • CoA synthaseUKR1
  • CoASY
  • Coenzyme A synthase
  • DPCK
  • FLJ35179
  • NBPbifunctional coenzyme A synthase
  • nucleotide binding protein
  • phosphopantetheine adenylyltransferase / dephosphocoenzyme A kinase
  • pOV-2
  • PPAT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2200
Species: Hu
Applications: WB, IP
NBP1-83288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NBP2-14977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007884-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84991
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COASY Antibody (NBP1-84991) (0)

There are no publications for COASY Antibody (NBP1-84991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COASY Antibody (NBP1-84991) (0)

There are no reviews for COASY Antibody (NBP1-84991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COASY Antibody (NBP1-84991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COASY Products

Bioinformatics Tool for COASY Antibody (NBP1-84991)

Discover related pathways, diseases and genes to COASY Antibody (NBP1-84991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COASY Antibody (NBP1-84991)

Discover more about diseases related to COASY Antibody (NBP1-84991).
 

Pathways for COASY Antibody (NBP1-84991)

View related products by pathway.

PTMs for COASY Antibody (NBP1-84991)

Learn more about PTMs related to COASY Antibody (NBP1-84991).

Blogs on COASY

There are no specific blogs for COASY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COASY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COASY