CNTFR Antibody

Images

 
Western Blot: CNTFR Antibody [NBP1-68943] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: CNTFR Antibody [NBP1-68943] - A549, H441.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNTFR Antibody Summary

Immunogen
Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG.
Specificity
This product is specific to Subunit or Isofrom: alpha.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTFR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CNTFR and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CNTFR Antibody

  • ciliary neurotrophic factor receptor alpha
  • ciliary neurotrophic factor receptor subunit alpha
  • ciliary neurotrophic factor receptor
  • CNTF receptor subunit alpha
  • CNTFR alpha
  • CNTFR-alpha
  • MGC1774

Background

This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
557-NT/CF
Species: Rt
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for CNTFR Antibody (NBP1-68943) (0)

There are no publications for CNTFR Antibody (NBP1-68943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNTFR Antibody (NBP1-68943) (0)

There are no reviews for CNTFR Antibody (NBP1-68943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNTFR Antibody (NBP1-68943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNTFR Products

Bioinformatics Tool for CNTFR Antibody (NBP1-68943)

Discover related pathways, diseases and genes to CNTFR Antibody (NBP1-68943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNTFR Antibody (NBP1-68943)

Discover more about diseases related to CNTFR Antibody (NBP1-68943).
 

Pathways for CNTFR Antibody (NBP1-68943)

View related products by pathway.

PTMs for CNTFR Antibody (NBP1-68943)

Learn more about PTMs related to CNTFR Antibody (NBP1-68943).
 

Research Areas for CNTFR Antibody (NBP1-68943)

Find related products by research area.

Blogs on CNTFR

There are no specific blogs for CNTFR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNTFR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTFR
Uniprot