CNTFR Antibody - BSA Free

Western Blot: CNTFR Antibody [NBP1-68943] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Western Blot: CNTFR Antibody [NBP1-68943] - A549 , H441.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CNTFR Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: alpha.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNTFR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CNTFR Antibody - BSA Free

• ciliary neurotrophic factor receptor alpha
• ciliary neurotrophic factor receptor subunit alpha
• ciliary neurotrophic factor receptor
• CNTF receptor subunit alpha
• CNTFR alpha
• CNTFR-alpha
• MGC1774

Background

This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNTFR
• Uniprot:
  • P26992()