CNBP Antibody


Western Blot: CNBP Antibody [NBP2-55690] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: CNBP Antibody [NBP2-55690] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

CNBP Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Specificity of human CNBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNBP Recombinant Protein Antigen (NBP2-55690PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CNBP Antibody

  • CCHC-type zinc finger, nucleic acid binding protein
  • cellular nucleic acid binding protein
  • cellular nucleic acid-binding protein
  • DM2
  • erythroid differentiation-related
  • FLJ11631
  • sterol regulatory element-binding protein
  • zinc finger protein 273
  • zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
  • Zinc finger protein 9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
Species: Hu
Applications: WB, IHC, IHC-P, KD, Simple Western (-)
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for CNBP Antibody (NBP2-55690) (0)

There are no publications for CNBP Antibody (NBP2-55690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNBP Antibody (NBP2-55690) (0)

There are no reviews for CNBP Antibody (NBP2-55690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNBP Antibody (NBP2-55690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CNBP Antibody (NBP2-55690)

Discover related pathways, diseases and genes to CNBP Antibody (NBP2-55690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNBP Antibody (NBP2-55690)

Discover more about diseases related to CNBP Antibody (NBP2-55690).

Pathways for CNBP Antibody (NBP2-55690)

View related products by pathway.

PTMs for CNBP Antibody (NBP2-55690)

Learn more about PTMs related to CNBP Antibody (NBP2-55690).

Blogs on CNBP

There are no specific blogs for CNBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNBP Antibody and receive a gift card or discount.


Gene Symbol CNBP