CNBP Antibody

Images

 
Western Blot: CNBP Antibody [NBP2-55690] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: CNBP Antibody [NBP2-55690] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNBP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Specificity
Specificity of human CNBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNBP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNBP Recombinant Protein Antigen (NBP2-55690PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CNBP Antibody

  • CCHC-type zinc finger, nucleic acid binding protein
  • cellular nucleic acid binding protein
  • cellular nucleic acid-binding protein
  • DM2
  • erythroid differentiation-related
  • FLJ11631
  • PROMM
  • RNF163CNBP1ZNF9ZCCHC22
  • sterol regulatory element-binding protein
  • zinc finger protein 273
  • zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
  • Zinc finger protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-69045
Species: Hu
Applications: ICC/IF
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-55690
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for CNBP Antibody (NBP2-55690) (0)

There are no publications for CNBP Antibody (NBP2-55690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNBP Antibody (NBP2-55690) (0)

There are no reviews for CNBP Antibody (NBP2-55690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNBP Antibody (NBP2-55690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CNBP Antibody (NBP2-55690)

Discover related pathways, diseases and genes to CNBP Antibody (NBP2-55690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNBP Antibody (NBP2-55690)

Discover more about diseases related to CNBP Antibody (NBP2-55690).
 

Pathways for CNBP Antibody (NBP2-55690)

View related products by pathway.

PTMs for CNBP Antibody (NBP2-55690)

Learn more about PTMs related to CNBP Antibody (NBP2-55690).

Blogs on CNBP

There are no specific blogs for CNBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNBP