![Western Blot: CNBP Antibody [NBP2-55690] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://images.novusbio.com/fullsize2/CNBP Antibody-Western Blot-NBP2-55690-img0002.jpg "Western Blot: CNBP Antibody [NBP2-55690] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG |
| Specificity | Specificity of human CNBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CNBP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for CNBP Antibody (NBP2-55690)Discover more about diseases related to CNBP Antibody (NBP2-55690).
| Pathways for CNBP Antibody (NBP2-55690)View related products by pathway.
|
PTMs for CNBP Antibody (NBP2-55690)Learn more about PTMs related to CNBP Antibody (NBP2-55690).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CNBP |
![Immunocytochemistry/Immunofluorescence: CNBP Antibody [NBP2-55690] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/CNBP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55690-img0001.jpg "Immunocytochemistry/Immunofluorescence: CNBP Antibody [NBP2-55690] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol. Antibody staining is shown in green.")
![Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Hepatic SREBP1c and SREBP2 protein abundance in C57BL/6 mice assigned to a high-fat (HF) or a high-fat/exercise (HF + EX) group for 8 weeks. Cytosolic and nuclear SREBP1c abundance. Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/jl/2013/908048/), licensed under a CC-BY licence.](http://images.novusbio.com/images2/SREBP1 Antibody (2A4)-Western Blot-NB600-582-img0004.jpg)
![Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Analysis of whole cell lysate from HeLa cells showing a single specific band for the expression of SREBP1 precursor protein (~120 kDa).](http://images.novusbio.com/images2/SREBP1-Antibody-(2A4)-Western-Blot-NB600-582-img0002.jpg)
![Simple Western: SREBP1 Antibody (2A4) [NB600-582] - Lane view shows a specific band for SREBP1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/SREBP1-Antibody-(2A4)-Simple-Western-NB600-582-img0003.jpg)
![Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Western-Blot-NBP2-34260-img0006.jpg)
![Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-NBP2-34260-img0005.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![Western Blot: CCT3 Antibody [NBP1-86562] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-CCT3 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/images2/CCT3-Antibody-Western-Blot-NBP1-86562-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: CCT3 Antibody [NBP1-86562] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/CCT3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86562-img0011.jpg)
![Immunohistochemistry-Paraffin: CCT3 Antibody [NBP1-86562] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/CCT3-Antibody-Immunohistochemistry-Paraffin-NBP1-86562-img0010.jpg)
![Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.](http://images.novusbio.com/images2/Fatty-Acid-Synthase-FASN-Antibody-Western-Blot-NB400-114-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.](http://images.novusbio.com/images2/Fatty-Acid-Synthase-FASN-Antibody-Immunocytochemistry-Immunofluorescence-NB400-114-img0010.jpg)
![Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.](http://images.novusbio.com/images2/Fatty-Acid-Synthase-FASN-Antibody-Immunohistochemistry-Paraffin-NB400-114-img0009.jpg)
![Western Blot: SREBP2 Antibody (1D2) [NBP1-54446] - Lane1: HEp-2 cells. Lane 2: MCF-7 cells. Lane 3: LNCaP cells. Lane 4: HT1080 cells. Lane 5: ZR75-1 cells.](http://images.novusbio.com/images2/SREBP2-Antibody-(1D2)-Western-Blot-NBP1-54446-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: SREBP2 Antibody (1D2) [NBP1-54446] - SREBP2 (1D2) antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/images2/SREBP2-Antibody-(1D2)-Immunocytochemistry-Immunofluorescence-NBP1-54446-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: ZNF273 Antibody [NBP2-69045] - Staining of human cell line RH-30 shows localization to nucleoplasm.](http://images.novusbio.com/images2/ZNF273-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-69045-img0001.jpg)
![Western Blot: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - MBNL1 monoclonal antibody (M02), clone 3E7 Analysis of MBNL1 expression in Hela S3 NE.](http://images.novusbio.com/images2/Muscleblind-like-1-Antibody-(3E7)-Western-Blot-H00004154-M02-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/Muscleblind-like-1-Antibody-(3E7)-Immunocytochemistry-Immunofluorescence-H00004154-M02-img0006.jpg)
![Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 0.75 ug/ml.](http://images.novusbio.com/images2/Muscleblind-like-1-Antibody-(3E7)-Immunohistochemistry-Paraffin-H00004154-M02-img0008.jpg)
![Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.](http://images.novusbio.com/images2/PPAR-alpha-NR1C1-Antibody-(3B6-PPAR)-Flow-Cytometry-NB300-537-img0008.jpg)
![Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.](http://images.novusbio.com/images2/PPAR-alpha-NR1C1-Antibody-(3B6-PPAR)-Western-Blot-NB300-537-img0006.jpg)
![Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Hek293 cells with PPAR alpha/NR1C1 [3B6/PPAR] Antibody NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.](http://images.novusbio.com/images2/PPAR-alpha-NR1C1-Antibody-(3B6-PPAR)-Flow-Cytometry-NB300-537-img0009.jpg)
![Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.](http://images.novusbio.com/images2/PPAR-gamma-NR1C3-Antibody-Western-Blot-NBP2-22106-img0003.jpg)
![Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.](http://images.novusbio.com/images2/PPAR-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-22106-img0001.jpg)
![Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.](http://images.novusbio.com/images2/PPAR-gamma-Antibody-Western-Blot-NBP2-22106-img0002.jpg)
![Western Blot: LDL R Antibody (C7) [NBP1-78159] - Total protein from human HeLa and HepG2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/mL anti-LDL receptor in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/images2/LDL-R-Antibody-(C7)-Western-Blot-NBP1-78159-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.](http://images.novusbio.com/images2/LDL-R-Antibody-(C7)-Immunocytochemistry-Immunofluorescence-NBP1-78159-img0007.jpg)
![Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.](http://images.novusbio.com/images2/LDL-R-Antibody-(C7)-Immunohistochemistry-NBP1-78159-img0006.jpg)
![Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.](http://images.novusbio.com/images2/Thyroglobulin-Antibody-(2H11-+-6E1)-Immunohistochemistry-Paraffin-NBP2-34294-img0005.jpg)
![Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).](http://images.novusbio.com/images2/Thyroglobulin-Antibody-(2H11-+-6E1)-Immunohistochemistry-Paraffin-NBP2-34294-img0003.jpg)
![Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.](http://images.novusbio.com/images2/Thyroglobulin-Antibody-(2H11-+-6E1)-Immunohistochemistry-NBP2-34294-img0004.jpg)
![Simple Western: HMG-CoA Reductase/HMGCR Antibody (JF0981) [NBP2-66888] - SVG-A whole cell lysate. Antibody at 1:25 dilution. Image from verified customer review.](http://images.novusbio.com/images2/HMG-CoA-Reductase-HMGCR-Antibody-(JF0981)-Simple-Western-NBP2-66888-img0002.jpg)
![HMG-CoA Reductase/HMGCR Antibody (JF0981) [NBP2-66888] - Analysis of HMGCR on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (ET1702-41, 1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody (HA1001) at 1:5,000 dilution was used for 1 hour at room temperature.Positive control: Lane 1: Hela cell lysateLane 2: THP-1 cell lysate](http://images.novusbio.com/images2/HMG-CoA-Reductase-HMGCR-Antibody-(JF0981)-NBP2-66888-img0003.jpg)
![Immunohistochemistry-Paraffin: Insulin Receptor beta Antibody [NBP2-12793] - Staining shows expression of insulin receptor beta in the Cortex in mouse brain. Dilution 1:500](http://images.novusbio.com/images2/Insulin-Receptor-beta-Antibody-Immunohistochemistry-Paraffin-NBP2-12793-img0002.jpg)
![Immunoprecipitation: Insulin Receptor beta Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).](http://images.novusbio.com/images2/Insulin-Receptor-beta-Antibody-Immunoprecipitation-NBP2-12793-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")