CMG-2/ANTXR2 Antibody

Images

 
Western Blot: ANTXR2 Antibody [NBP1-68911] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CMG-2/ANTXR2 Antibody Summary

Immunogen
Synthetic peptides corresponding to Antxr2 (anthrax toxin receptor 2) The peptide sequence was selected from the N terminal of Antxr2. Peptide sequence GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANTXR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Antxr2 and was validated on Western blot.
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CMG-2/ANTXR2 Antibody

  • anthrax toxin receptor 2
  • ANTXR2
  • Capillary morphogenesis gene 2 protein
  • capillary morphogenesis protein 2
  • cI-35
  • CMG2
  • CMG-2
  • CMG2MGC111533
  • CMG-2MGC45856
  • FLJ31074
  • ISH
  • JHF
  • JHS

Background

Antxr2 is necessary for cellular interactions with laminin and the extracellular matrix.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready

Publications for CMG-2/ANTXR2 Antibody (NBP1-68911) (0)

There are no publications for CMG-2/ANTXR2 Antibody (NBP1-68911).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMG-2/ANTXR2 Antibody (NBP1-68911) (0)

There are no reviews for CMG-2/ANTXR2 Antibody (NBP1-68911). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CMG-2/ANTXR2 Antibody (NBP1-68911) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CMG-2/ANTXR2 Products

Bioinformatics Tool for CMG-2/ANTXR2 Antibody (NBP1-68911)

Discover related pathways, diseases and genes to CMG-2/ANTXR2 Antibody (NBP1-68911). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMG-2/ANTXR2 Antibody (NBP1-68911)

Discover more about diseases related to CMG-2/ANTXR2 Antibody (NBP1-68911).
 

Pathways for CMG-2/ANTXR2 Antibody (NBP1-68911)

View related products by pathway.

PTMs for CMG-2/ANTXR2 Antibody (NBP1-68911)

Learn more about PTMs related to CMG-2/ANTXR2 Antibody (NBP1-68911).

Blogs on CMG-2/ANTXR2

There are no specific blogs for CMG-2/ANTXR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CMG-2/ANTXR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANTXR2
Entrez
Uniprot