CMAS Antibody

Images

 
Western Blot: CMAS Antibody [NBP1-85858] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CMAS Antibody [NBP1-85858] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CMAS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CMAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CMAS Protein (NBP1-85858PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CMAS Antibody

  • CMP-N-acetylneuraminic acid synthase
  • CMP-N-acetylneuraminic acid synthetase
  • CMP-Neu5Ac synthetase
  • CMP-NeuNAc synthase
  • CMP-NeuNAc synthetase
  • cytidine 5'-monophosphate N-acetylneuraminic acid synthetase
  • cytidine monophosphate N-acetylneuraminic acid synthetase
  • EC 2.7.7.43
  • N-acylneuraminate cytidylyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC

Publications for CMAS Antibody (NBP1-85858) (0)

There are no publications for CMAS Antibody (NBP1-85858).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMAS Antibody (NBP1-85858) (0)

There are no reviews for CMAS Antibody (NBP1-85858). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CMAS Antibody (NBP1-85858) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CMAS Products

Bioinformatics Tool for CMAS Antibody (NBP1-85858)

Discover related pathways, diseases and genes to CMAS Antibody (NBP1-85858). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMAS Antibody (NBP1-85858)

Discover more about diseases related to CMAS Antibody (NBP1-85858).
 

Pathways for CMAS Antibody (NBP1-85858)

View related products by pathway.

PTMs for CMAS Antibody (NBP1-85858)

Learn more about PTMs related to CMAS Antibody (NBP1-85858).

Blogs on CMAS

There are no specific blogs for CMAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CMAS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CMAS