CLEC4E Antibody

Images

 
Western Blot: CLEC4E Antibody [NBP2-13844] - Analysis in human spleen tissue.
Immunocytochemistry/ Immunofluorescence: CLEC4E Antibody [NBP2-13844] - Staining of human cell line U-251MG shows positivity in cytoplasm. Dilution: 1 4 ug/ml
Immunohistochemistry-Paraffin: CLEC4E Antibody [NBP2-13844] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLEC4E Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFI GLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPR QNWNDVTCFLNYFRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC4E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLEC4E Protein (NBP2-13844PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLEC4E Antibody

  • CLEC4E
  • CLECSF9
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 9
  • C-type lectin domain family 4 member E
  • C-type lectin domain family 4, member E
  • Macrophage-inducible C-type lectin
  • MINCLE
  • MINCLEC-type lectin superfamily member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2806
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
MAB1859
Species: Hu
Applications: Flow, Block, CyTOF-ready, ICC
NBP2-27159
Species: Hu
Applications: WB, Flow, IHC-P, CyTOF-ready
DDX0180P-100
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, Flow-CS
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
H00010875-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
AF2950
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF5085
Species: Hu, Mu, Rt
Applications: WB, ICC
AF5248
Species: Hu
Applications: WB
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF

Publications for CLEC4E Antibody (NBP2-13844) (0)

There are no publications for CLEC4E Antibody (NBP2-13844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC4E Antibody (NBP2-13844) (0)

There are no reviews for CLEC4E Antibody (NBP2-13844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLEC4E Antibody (NBP2-13844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLEC4E Products

Bioinformatics Tool for CLEC4E Antibody (NBP2-13844)

Discover related pathways, diseases and genes to CLEC4E Antibody (NBP2-13844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLEC4E Antibody (NBP2-13844)

Discover more about diseases related to CLEC4E Antibody (NBP2-13844).
 

Pathways for CLEC4E Antibody (NBP2-13844)

View related products by pathway.

Blogs on CLEC4E

There are no specific blogs for CLEC4E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLEC4E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC4E
Entrez